NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17598.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17598.1 Public Mus musculus 3 Rfx5 16 104 75 CCDS HistoryNCBI Gene:53970Re-query CCDS DB by CCDS ID:17598.1Re-query CCDS DB by GeneID:53970

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17598.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029772 ENSMUSP00000029772 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029772Link to Ensembl Protein Viewer:ENSMUSP00000029772Re-query CCDS DB by Nucleotide ID:ENSMUST00000029772Re-query CCDS DB by Protein ID:ENSMUSP00000029772
Original member Current member EBI,WTSI ENSMUST00000107255 ENSMUSP00000102876 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107255Link to Ensembl Protein Viewer:ENSMUSP00000102876Re-query CCDS DB by Nucleotide ID:ENSMUST00000107255Re-query CCDS DB by Protein ID:ENSMUSP00000102876
Original member Current member EBI,WTSI ENSMUST00000107260 ENSMUSP00000102881 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107260Link to Ensembl Protein Viewer:ENSMUSP00000102881Re-query CCDS DB by Nucleotide ID:ENSMUST00000107260Re-query CCDS DB by Protein ID:ENSMUSP00000102881
Original member Current member EBI,WTSI ENSMUST00000137088 ENSMUSP00000117963 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000137088Link to Ensembl Protein Viewer:ENSMUSP00000117963Re-query CCDS DB by Nucleotide ID:ENSMUST00000137088Re-query CCDS DB by Protein ID:ENSMUSP00000117963
Original member Current member EBI,WTSI OTTMUST00000055675 OTTMUSP00000026691 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055675Link to Vega Protein Viewer:OTTMUSP00000026691Re-query CCDS DB by Nucleotide ID:OTTMUST00000055675Re-query CCDS DB by Protein ID:OTTMUSP00000026691
Original member Current member EBI,WTSI OTTMUST00000055676 OTTMUSP00000026692 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055676Link to Vega Protein Viewer:OTTMUSP00000026692Re-query CCDS DB by Nucleotide ID:OTTMUST00000055676Re-query CCDS DB by Protein ID:OTTMUSP00000026692
Original member Current member EBI,WTSI OTTMUST00000082651 OTTMUSP00000044332 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000082651Link to Vega Protein Viewer:OTTMUSP00000044332Re-query CCDS DB by Nucleotide ID:OTTMUST00000082651Re-query CCDS DB by Protein ID:OTTMUSP00000044332
Original member Current member NCBI NM_017395.2 NP_059091.2 Accepted alive Link to Nucleotide Sequence:NM_017395.2Link to Protein Sequence:NP_059091.2Re-query CCDS DB by Nucleotide ID:NM_017395Re-query CCDS DB by Protein ID:NP_059091Link to BLink:NP_059091.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_059091.2 658 Q9JL61 658 100% 0 0

Chromosomal Locations for CCDS 17598.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 94955034 94955146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94955352 94955385 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94955746 94955828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94956272 94956391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94956487 94956606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94956721 94956802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94957097 94957298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94957782 94957885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 94958250 94959368 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1977 nt):
ATGGCAGAAGATAAACCTGATGCTAAGAGCCCCAAGACTGGGGCAAGGCCCCAAGGTGGTGCTGACGCTG
GA
GAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCATTTCCAAGGCCGTGCAGAACAAAGTAGAGGG
A
ATTCTGCAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGG
CCC
AGCGTTGGCGAGAAGAGCTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGT
GG
ATCCGCAACCACCTGGAAGAGCACATGGATACCTGCCTGCCAAAGCAGAGCGTCTATGATGCCTATCG
A
AAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATCATCAGAGAG
ATC
TTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAAATATTGCTACAGTGGCATTC
GA
AGGAAGACCTTGGTATCCATGCCACCATTGCCTGGACTCGACTTGAAGGGATCTGAAAGTCCAGAAAT
G
GGCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCCTGTGCCCTGACTTGTGACTGG
GCA
GAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATC
TC
ATCTCTGCCCGGTCGGCACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTGAAGAGGATGAAAGAGC
C
CCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCGTAGAAAGCCTGGAAGGGGGAGGCCCTAAGAAA
CCA
GAGAGACCGGCCCAGCCTCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAG
AA
CGGAAGAAGAGTGTAATTGACAGCTCGGTTCCAGCAGCCAGTAAGCCACAAGTTAATGCTCTTGTGGC
C
CGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCACTTATCACACCCATTTCAGGCACTCTGAAAGTA
GCT
ACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCTTAC
CA
CCTGTTCCTACTTTGTCAGGGGCTGGGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCAGG
G
CCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTGGGGGCTGGTCTGGGGCCTGGGTTAGGGCCTGGGCTT
GGA
GCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGCGAGTTC
CA
CCTAGAGCACCCATTCTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACC
T
CATGACAAGGGTATCAAAAGGACAGCTGAAGTGCCTCTGAGTGAGGCCAGTGGGCAGGACCCACCAGTT
AAA
GAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAGCGAGGACGCCCTCGAA
AG
AAGCCAGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCG
A
TCCCCAAGGCTACTCTGGGAGACATGGGGCTCAAAAAGAGAAAACAACTTCATTGGGAGACCAGAAGGA
CCA
GGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCAAGGTCAGCAAGATGGTGCTGTTTCCA
AA
GGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTCAAA
A
GTGAGTGTTATCAAGGGCAGAATTCAAAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTGCA
ACA
CAGGGCAACAAAGGGTTAAAGGGTCGTGTACTTCAAAGTTCCCTAACCCCTGAGCATAAAGACCCCA
AA
GCAACACCCCCATGA


Translation (658 aa):
MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLPSG
P
SVGEK
SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIRE
I
FPDIKARRLGGRGQS
KYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVSPAPRDELVEAACALTCDW
A
ERILKRSFSSIVQVARYLLQQHLISARSAHAHVLKAGGLA
EEDERAPRERSLCKSKNVVESLEGGGPKK
P
ERPAQ
PPKEQEARAGTDLPGRAERKKSVIDSSVPAASKPQVNALVARLPVLLPRAPRSLITPISGTLKV
A
TLPLPTRVGGPQTAVPIINMILPPVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGL
G
AGPGPGLGAGLGAGLGLGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPV
K
EMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWGSKRENNFIGRPEG
P
GPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAA
T
QGNKGLKGRVLQSSLTPEHKDPKATPP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser