NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16958.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16958.1 Public Mus musculus 2 Gdf5 16 104 75 CCDS HistoryNCBI Gene:14563Re-query CCDS DB by CCDS ID:16958.1Re-query CCDS DB by GeneID:14563

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16958.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040162 ENSMUSP00000048079 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040162Link to Ensembl Protein Viewer:ENSMUSP00000048079Re-query CCDS DB by Nucleotide ID:ENSMUST00000040162Re-query CCDS DB by Protein ID:ENSMUSP00000048079
Original member Current member EBI,WTSI OTTMUST00000038081 OTTMUSP00000017076 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000038081Link to Vega Protein Viewer:OTTMUSP00000017076Re-query CCDS DB by Nucleotide ID:OTTMUST00000038081Re-query CCDS DB by Protein ID:OTTMUSP00000017076
Original member Current member NCBI NM_008109.2 NP_032135.2 Accepted alive Link to Nucleotide Sequence:NM_008109.2Link to Protein Sequence:NP_032135.2Re-query CCDS DB by Nucleotide ID:NM_008109Re-query CCDS DB by Protein ID:NP_032135Link to BLink:NP_032135.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032135.2 495 P43027 495 100% 0 0

Chromosomal Locations for CCDS 16958.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 155941543 155942417 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 155944443 155945055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGAGACTCCCCAAACTCCTCACTCTTTTGCTGTGGCACCTGGCTTGGCTGGACCTGGAACTCATCTGCA
CT
GTGCTGGGTGCCCCTGACTTAGGACAGAGAACCCCAGGGGCCAAGCCAGGGTTGACCAAAGCGGAGGC
C
AAGGAGAGGCCACCCCTGGCCAGGAATGTCTTTAGGCCAGGGGGTCATATCTATGGTGTGGGGGCCACC
AAT
GCCAGGGCCAAGGGAAGCTCTGGGCAGACACAGGCCAAGAAGGATGAACCCAGAAAGATGCCCCCCA
GA
TCCGGTGGCCCTGAAACCAAGCCAGGACCCTCTTCCCAGACTAGACAGGCTGCAGCCCGGACTGTAAC
C
CCAAAAGGACAGCTTCCTGGGGGCAAAGCATCTTCAAAAGCAGGATCTGCCCCCAGCTCCTTCCTGCTG
AAG
AAGACCAGGGAGCCTGGGACCCCTCGAGAGCCCAAGGAGCCGTTCCGCCCGCCCCCCATCACACCCC
AC
GAATACATGCTCTCCCTGTACAGGACGCTGTCCGATGCTGACAGAAAGGGAGGTAACAGCAGCGTGAA
G
TTGGAGGCTGGCCTGGCCAACACCATCACCAGCTTTATTGACAAAGGGCAAGATGACCGAGGCCCTGCG
GTC
AGGAAGCAGAGGTACGTGTTTGACATCAGTGCCTTGGAGAAGGATGGGCTGTTGGGGGCTGAACTGC
GG
ATCTTACGGAAGAAGCCCTTGGACGTGGCCAAGCCAGCGGTCCCCAGTAGCGGGCGGGTTGCCCAACT
G
AAGCTGTCCAGCTGCCCCAGCGGCCGGCAGCCGGCAGCCTTGCTGGATGTGCGCTCCGTGCCAGGCCTG
GAT
GGATCTGGCTGGGAGGTGTTCGACATCTGGAAGCTCTTCCGAAATTTTAAGAACTCAGCGCAGCTGT
GC
CTGGAGCTGGAGGCCTGGGAACGGGGCCGGGCCGTGGACCTCCGTGGCCTGGGCTTTGAACGCACTGC
C
CGACAGGTCCACGAGAAAGCCTTGTTCCTAGTGTTTGGTCGTACCAAGAAACGGGACCTGTTCTTTAAT
GAG
ATTAAGGCCCGCTCTGGCCAGGATGACAAGACTGTGTATGAATATTTGTTCAGCCAGCGGCGGAAAC
GC
CGGGCCCCATTGGCCAATCGCCAGGGCAAGCGACCCAGCAAGAACCTCAAGGCTCGCTGCAGTCGCAA
G
GCCTTGCATGTCAACTTCAAGGACATGGGCTGGGACGACTGGATCATCGCACCTCTTGAGTATGAGGCC
TTC
CACTGCGAAGGACTGTGTGAGTTCCCCTTGCGCTCCCACTTGGAGCCCACAAACCACGCAGTCATTC
AG
ACCCTAATGAACTCTATGGACCCTGAATCCACACCACCCACTTGTTGTGTGCCTACACGGCTGAGTCC
T
ATTAGCATCCTCTTCATCGACTCTGCCAACAACGTGGTGTATAAACAGTACGAGGACATGGTCGTGGAA
TCT
TGTGGCTGCAGGTAG


Translation (495 aa):
MRLPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKAEAKERPPLARNVFRPGGHIYGVGAT
N
ARAKGSSGQTQAKKDEPRKMPPRSGGPETKPGPSSQTRQAAARTVTPKGQLPGGKASSKAGSAPSSFLL
K
KTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRKGGNSSVKLEAGLANTITSFIDKGQ
DDRGPA
V
RKQRYVFDISALEKDGLLGAELRILRKKPLDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGL
D
GSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFN
E
IKARSGQDDKTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEA
F
HCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVE
S
CGCR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser