NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16579.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16579.1 Public Mus musculus 2 Bub1b 16 104 75 CCDS HistoryNCBI Gene:12236Re-query CCDS DB by CCDS ID:16579.1Re-query CCDS DB by GeneID:12236

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16579.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000038341 ENSMUSP00000037126 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038341Link to Ensembl Protein Viewer:ENSMUSP00000037126Re-query CCDS DB by Nucleotide ID:ENSMUST00000038341Re-query CCDS DB by Protein ID:ENSMUSP00000037126
Original member Current member EBI,WTSI OTTMUST00000036418 OTTMUSP00000016369 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000036418Link to Vega Protein Viewer:OTTMUSP00000016369Re-query CCDS DB by Nucleotide ID:OTTMUST00000036418Re-query CCDS DB by Protein ID:OTTMUSP00000016369
Original member Current member NCBI NM_009773.3 NP_033903.2 Accepted alive Link to Nucleotide Sequence:NM_009773.3Link to Protein Sequence:NP_033903.2Re-query CCDS DB by Nucleotide ID:NM_009773Re-query CCDS DB by Protein ID:NP_033903Link to BLink:NP_033903.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033903.2 1052 Q9Z1S0 1052 100% 0 0

Chromosomal Locations for CCDS 16579.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 118598448 118598461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118600138 118600284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118605414 118605473 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118606544 118606688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118609783 118609979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118612575 118612741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118614931 118615145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118615444 118615535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118617706 118617935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118622135 118622247 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118623070 118623185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118624281 118624330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118626023 118626080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118626853 118626961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118629903 118630165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118630945 118631078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118631759 118631899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118632411 118632511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118635128 118635277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118636700 118636842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118638401 118638575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118639633 118639739 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118641088 118641319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3159 nt):
ATGGCGGAGGCGAGTGAAGCCATGTGCCTGGAGGGAGCAGAGTGGGAGCTGAGTAAAGAAAACATACAGC
CC
TTACGGCACGGGCGGGTCATGTCCACACTTCAGGGAGCTTTGGCAAAGCAAGAGTCAGCCGGCCACAC
T
GCTCTGCAGCAGCAGAAACGGGCATTTGAATCTGAAATCCGCTTTTACTCTGGAGATGACCCTCTGGAT
GTG
TGGGACAGATATATTAATTGGACAGAACAGAACTACCCTCAAGGGGGGAAAGAGAGTAACATGTCAG
CG
TTAGTGGAGAGAGCGATAGAAGCACTCCAAGGAGAGACGCGCTATTATAATGACCCCCGCTTTCTCAG
T
CTCTGGATCAAATTGGGACATTTGTGCAATGAACCTTTGGATATGTACAGCTATTTACAAAGCCAAGGA
ATT
GGCGTTTCCCTTGCCCAGTTCTATATTTCATGGGCTGAAGAATACGAAGCTAGAGAAAATTTCAAGA
AA
GCGGACATAATATTCCAGGAAGGGATTGAACGCAAGGCTGAGCCCCTGGACAGACTGCAGTCCCAGCA
C
AGACAGTTCCAGTCTCGAGTGTCGCGACAAGCTTTCTTGGCCCTTGGGAATGAAGAGGAGGAGGCTTTG
GAG
CCTTCTGAACCACAGAGAAGCTCGCTAGCTGAGCTGAAGAGCAGAGGGAAGAAGATGGCCAGAGCGC
CC
ATCAGCCGTGTCGGAGGTGCTCTGAAAGCTCCAGGTCAGAGCAGAGGGTTCCTAAATGCAGTTCCCCA
G
CCAGTACACGGTAATCGCAGGATCACCGTTTTTGATGAAAATGCCGATACCGCGTCTAGAACGGAGTTA
TCT
AAGCCTGTAGCCCAGCCATGGATGGCACCCCCTGTGCCCAGGGCCAAAGAGAACGAACTTCAGCCAG
GC
CCATGGAGCACAGACAGGCCGGCGGGACGCAGGCCTCATGACAATCCAGCCTCTGTGACGTCGATTCC
C
AGCGTGCTTCCCAGCTTTACGCCGTACGTGGAAGAGAGCGCCCAGCAGACAGTCATGACACCATGCAAG
ATT
GAGCCTAGTATCAACCATGTTCTCAGCACCAGGAAGCCAGGGAGAGAAGAAGGAGACCCCTTGCAGA
GA
GTTCAGAGTCATCAGCAAGGCTGTGAGGAGAAGAAGGAGAAGATGATGTACTGTAAGGAGAAGATCTA
T
GCCGGAGTTGGGGAGTTCTCCTTTGAGGAGATCCGAGCTGAAGTGTTCCGAAAGAAGCTGAAAGAACGA
AGG
GAAGCCGAGCTGTTGACCAGTGCAAAGAAGAGGGAGGAGATGCAGAAGCAGATCGAAGAGATGGAGA
GG
AGGCTGAAGGCAATGCAGGCTGTTCAGCAAGAAGGAGCTGGGGGCCAGCAAGAAGAGAAGATGCCTAC
A
GAGGACCCAGCCAGATTGCAGATTGCTTCGGGGCCTCAGGAAATGTCGGGAGTTCCTCTGTCCTGTTCC
ATC
TGTCCACTAAGCTCGAATCCTAGGGAAATTTCACCTGCTGAGAACATTTTGCAAGAACAGCCTGATT
CT
AAAGGTTCCAGTATGCCTTTCTCCATTTTTGATGAGTCTCTTTCAGACAAAAAGGACAAAAGTCCTGC
T
ACAGGTGGTCCACAGGTTCTCAATGCCCAGAGAAGACCCCTTTCAGTTCTCAAAACTACAGAAGTGGGC
ACC
ACAAATGAGGATGTGTCTCCCGATATTTGTGATGAACTCACAGAACTTGAGCCTCTGAGTGAAGACG
CC
ATCATCACTGGTTTCAGGAACGTCACTCTCTGTCCCAACCCTGAGGACACTTGTGACTTTGCTAGAGC
A
GCTCGTTTGGCATCTACTCCTTTCCATGAGATACTGTCCTCGAAGGGCATCGCTGCTGATCCCGAGGGA
CTG
TTGCAGGAAGAGGATCTGGATGGGAAGGCCGCCGAGGCTCATCACACTGTTCATCACCAGGCCCTCA
TC
ATAAAGAAACTGAGCCCAATTATTGAAGAGAGCCGTGAGGCCACCCACTCATCTGGCTTCTCCAGGTC
T
TCTTCCTCAGCTCCCAGTACATCCTCCATCAAAGGCTTTCAGCTTCTGGAAAAGCTGGAGCTGACTAAT
GAC
GGGGCAGAAGATGCTATTCAGTCACCCTGGTGTTCACAGTATCGCCTACAACTGTTAAAATCCCTAC
TA
GAATTAAGTGCTTTTGCGGAGTTTTCTGTGGAAGACCGACCGATGCCTGTGCTGGAAATAGGGAAGGA
G
ATTGAGTTAGGTCCTGAGGATTACGTCATCAAGCAAGAGCACCTAACATGTGACGATTACAGGTTATTC
TGG
GTGGCACCAAGAAGCTCTGCAGAGCTAACCATGATAAAGGCATCATCTCAGCCTATCCCGTGGGATT
TT
TATATCAACCTCAAGTTGAAGGAGCGTCTGAATGAGGACTATGACCAGCTTTGCAGCTGCTGTCAGTA
C
CAAGATGGCCATGTTGTTTGGTACCAGTATATAAACTGCTCCACCCTTCAGAATCTTCTCCAACACAGC
GAA
TTTGTTACTCATGAAATAATAGTGTTGATTATTTACAACCTCTTGACAATCGTGGAGAAGCTACACA
GA
GCTGAAATAGTACACGGAGACTTGAGTCCACGGAGTCTGATCCTACGAAACAGAATCCACGACCCCTA
T
GACTATGTAAATAAGGACGATCACGCTGTGAGGATCATGGACTTCTCCTACAGTGTTGACCTGAGGGTG
CAG
CTGGATGCGTTTGCCTATAGTGGCTTTCGGACTGCACAGATCCTGGAAGGACAAAAGATCCTGGCTA
AC
TGTTCTTCTCCCTACCATGTAGATCTGTTGGGTATAGCAGACCTAGCGCACTTACTCCTGTTCAAGGA
G
CACCTCCATGTCTTCTGGGATGGACTCCTCTGGAAACTTAGCCAGAGCACCTCTGAGCTAAAAGACAGT
GAA
TTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAGTGACAAGTCCACAGTGTCTGTTCTGGGGG
AG
CTGGCAGCAGAAATGGGTGGGGCTTTTGATGCCACATTCCATAGCCACCTGAACAGAGCCCTGTGGAA
G
CTGGGGAAGACAATCAGCCCGGAAGCTTTGCTCACTCAGCAAGACAAGCAGCCAGGCGGCTCCCAGAGC
CCT
GCCTAA


Translation (1052 aa):
MAEASEAMCLEGAEWELSKENIQPLRHGRVMSTLQGALAKQESAGHTALQQQKRAFESEIRFYSGDDPLD
V
WD
RYINWTEQNYPQGGKESNMSALVERAIEALQGETRYYNDPRFLSLWIKLGHLCNEPLDMYSYLQSQG
I
GVSLAQFYISWAEEYEARENFKKADIIFQEGIERKAEPLDRLQSQH
RQFQSRVSRQAFLALGNEEEEAL
E
PSEPQRSSLAELKSRGKKMARAPISRVGGALK
APGQSRGFLNAVPQPVHGNRRITVFDENADTASRTEL
S
KPVAQPWMAPPVPRAKENELQPGPWSTDRPAGRR
PHDNPASVTSIPSVLPSFTPYVEESAQQTVMTPCK
I
EPSINHVLSTRKPGREEGDPLQRVQSHQQGCEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKER
R
E
AELLTSAKKREEMQKQIEEMERRLKAMQAVQQEGAGGQQEEKMPTEDPARLQIASGPQEMSGVPLSCS
I
CPLSSNP
REISPAENILQEQPDSKGSSMPFSIFDESLSDKKDKSPATGGPQVLNAQRRPLSVLKTTEVG
T
TNEDVSPDIC
DELTELEPLSEDAIITGFRNVTLCPNPEDTCDFARAARLASTPFHEILSSKGIAADPEG
L
LQEEDLDGKAAEAHHTVHHQALIIKKL
SPIIEESREATHSSGFSRSSSSAPSTSSIKGFQLLEKLELTN
D
GA
EDAIQSPWCSQYRLQLLKSLLELSAFAEFSVEDRPMPVLEIGKEIELGPEDYVIKQEHLTCDDYRLF
W
VAPRSSAELTMIK
ASSQPIPWDFYINLKLKERLNEDYDQLCSCCQYQDGHVVWYQYINCSTLQNLLQHS
E
FVTHEIIVLIIYNLLTIVEKLHRAEIVHGDLSPRSLILRN
RIHDPYDYVNKDDHAVRIMDFSYSVDLRV
Q
LDAFAYSGFRTAQILEGQKILANCSSPYH
VDLLGIADLAHLLLFKEHLHVFWDGLLWKLSQSTSELKDS
E
LWNKFFVRILNASDKSTVSVLGELAAEMGGAFDATFHSHLNRALWKLGKTISPEALLTQQDKQPGGSQS
P
A




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser