NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16418.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16418.1 Public Mus musculus 2 Ndufs3 16 104 75 CCDS HistoryNCBI Gene:68349Re-query CCDS DB by CCDS ID:16418.1Re-query CCDS DB by GeneID:68349

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16418.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000005647 ENSMUSP00000005647 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005647Link to Ensembl Protein Viewer:ENSMUSP00000005647Re-query CCDS DB by Nucleotide ID:ENSMUST00000005647Re-query CCDS DB by Protein ID:ENSMUSP00000005647
Original member Current member EBI,WTSI OTTMUST00000033776 OTTMUSP00000015131 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000033776Link to Vega Protein Viewer:OTTMUSP00000015131Re-query CCDS DB by Nucleotide ID:OTTMUST00000033776Re-query CCDS DB by Protein ID:OTTMUSP00000015131
Original member Current member NCBI NM_026688.2 NP_080964.1 Accepted alive Link to Nucleotide Sequence:NM_026688.2Link to Protein Sequence:NP_080964.1Re-query CCDS DB by Nucleotide ID:NM_026688Re-query CCDS DB by Protein ID:NP_080964Link to BLink:NP_080964.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080964.1 263 Q9DCT2 263 100% 0 0

Chromosomal Locations for CCDS 16418.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 90894710 90894877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90898384 90898503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90898637 90898762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90902363 90902512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90902847 90902944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90904423 90904488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 90904584 90904647 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGGCGGCGGCTGCAGCCAGGGTCTGGTGTCGTGGGCTCTTGGGGGCCGCTTCCGTAGGCAGGGGGGCTG
GG
CGACCCTCCGTGCTGTGGCAGCACGTAAGAAGGGAGAGCGCGGCGGCTGACAAGCGCCCCACTGTCAG
A
CCCCGGAGTGATGTGACCCACAAGCAGCTCTCAGCATTTGGAGAGTATGTGGCTGAAATCTTACCCAAG
TAT
GTCCAACAAGTTCAGGTGTCCTGCCTTGATGAGTTAGAAATCTGTATCCATCCCGATGGAGTCATCC
CA
ACGCTGACTTTTCTCAGGGATCACACCAATGCACAATTCAAATCCTTGGCTGACTTGACGGCAGTGGA
T
GTCCCAACTCGGCAGAACCGTTTTGAGATTGTCTACAACCTGCTGTCTCTGCGGTTCAACTCTAGGATT
CGT
GTGAAGACCTATGCAGATGAGCTGACACCCATTGACTCTATAGTGTCTGTGCACATCGCGGCCAATT
GG
TATGAGAGGGAGGTCTGGGACATGTTTGGAGTTTTCTTTTTTAACCACCCTGATTTAAGAAGGATCCT
G
ACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAAGACTTTCCCCTCACTGGCTATGTTGAGCTTCGT
TAC
GACGATGAGGTAAAGCGGGTAGTGGCTGAACCAGTGGAGCTGGCACAAGAATTCCGCAAGTTTGACC
TG
AACAGCCCCTGGGAGGCTTTCCCTGCCTATCGCCAGCCTCCTGAGAGTCTCAAGCTCGAAGCTGGAGA
C
AAGAAGCCTGAAACCAAGTAA


Translation (263 aa):
MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAFGEYVAEILPK
Y
VQQVQ
VSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRI
R
VKTYADELTPIDSIVSVHIAANWYERE
VWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELR
Y
DDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser