NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16108.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16108.1 Public Mus musculus 2 Gad1 16 104 75 CCDS HistoryNCBI Gene:14415Re-query CCDS DB by CCDS ID:16108.1Re-query CCDS DB by GeneID:14415

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16108.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094934 ENSMUSP00000092539 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094934Link to Ensembl Protein Viewer:ENSMUSP00000092539Re-query CCDS DB by Nucleotide ID:ENSMUST00000094934Re-query CCDS DB by Protein ID:ENSMUSP00000092539
Original member Current member EBI,WTSI OTTMUST00000083419 OTTMUSP00000044832 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000083419Link to Vega Protein Viewer:OTTMUSP00000044832Re-query CCDS DB by Nucleotide ID:OTTMUST00000083419Re-query CCDS DB by Protein ID:OTTMUSP00000044832
Original member Current member NCBI NM_008077.4 NP_032103.2 Accepted alive Link to Nucleotide Sequence:NM_008077.4Link to Protein Sequence:NP_032103.2Re-query CCDS DB by Nucleotide ID:NM_008077Re-query CCDS DB by Protein ID:NP_032103Link to BLink:NP_032103.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032103.2 593 P48318 593 100% 0 0

Chromosomal Locations for CCDS 16108.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 70563832 70563910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70567186 70567248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70572706 70572864 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70574069 70574311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70579111 70579201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70585834 70585946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70587123 70587238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70587323 70587402 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70587634 70587688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70589773 70589889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70591106 70591170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70593432 70593510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70594624 70594773 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70597162 70597269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70599609 70599698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 70600623 70600796 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1782 nt):
ATGGCATCTTCCACTCCTTCGCCTGCAACCTCCTCGAACGCGGGAGCGGATCCTAATACTACCAACCTGC
GC
CCTACAACGTATGATACTTGGTGTGGCGTAGCCCATGGATGCACCAGAAAACTGGGCCTGAAGATCTG
T
GGCTTCTTACAAAGGACCAATAGCCTGGAAGAGAAGAGTCGTCTTGTGAGCGCCTTCAGGGAGAGGCAG
TCC
TCCAAGAACCTGCTTTCCTGTGAAAACAGTGACCAGGGTGCCCGCTTCCGGCGCACAGAGACCGACT
TC
TCCAACCTGTTTGCTCAAGATCTGCTTCCAGCTAAGAACGGGGAGGAGCAAACTGCGCAGTTCTTGCT
G
GAAGTGGTAGACATACTCCTCAACTATGTCCGCAAGACATTTGATCGCTCCACCAAGGTTCTGGATTTC
CAC
CACCCACACCAGTTGCTGGAAGGCATGGAAGGCTTTAATTTGGAGCTGTCTGACCACCCCGAGTCTC
TG
GAGCAGATCCTGGTTGACTGTAGAGACACCCTGAAGTACGGGGTTCGCACAGGTCACCCTCGATTTTT
C
AACCAGCTCTCTACTGGTTTGGATATCATTGGTTTAGCTGGTGAATGGCTGACATCGACTGCCAATACC
AAT
ATGTTCACATATGAAATTGCACCCGTGTTTGTTCTCATGGAACAGATTACTCTTAAGAAGATGAGAG
AG
ATCGTTGGATGGTCAAATAAAGATGGTGATGGGATATTTTCTCCTGGGGGAGCCATATCCAATATGTA
C
AGCATCATGGCTGCTCGTTACAAGTACTTCCCAGAAGTGAAGACAAAAGGCATGGCGGCTGTGCCCAAA
CTG
GTCCTCTTCACCTCAGAACACAGTCACTATTCCATAAAGAAAGCCGGGGCTGCGCTTGGCTTTGGAA
CC
GACAATGTGATTTTGATAAAGTGCAATGAAAGGGGGAAGATAATTCCGGCTGATTTAGAGGCAAAAAT
T
CTTGATGCCAAACAAAAGGGCTATGTTCCCCTTTATGTCAATGCAACCGCAGGCACGACTGTTTACGGA
GCA
TTCGATCCAATCCAGGAAATTGCGGACATATGTGAGAAATACAACCTTTGGCTGCATGTGGATGCTG
CC
TGGGGTGGTGGACTGCTCATGTCCCGGAAGCACCGCCACAAACTCAGCGGCATAGAAAGGGCCAATTC
A
GTCACCTGGAACCCTCACAAGATGATGGGCGTGCTGCTCCAGTGCTCTGCCATTCTGGTCAAGGAAAAG
GGT
ATACTCCAAGGATGCAACCAGATGTGTGCAGGCTACCTCTTCCAGCCAGACAAGCAGTATGACGTCT
CC
TATGACACCGGGGACAAGGCGATTCAGTGTGGCCGCCATGTGGACATCTTCAAGTTCTGGCTGATGTG
G
AAAGCAAAGGGCACCGTGGGATTTGAAAACCAGATCAACAAATGCCTGGAGCTGGCTGATTACCTCTAC
GCC
AAGATTAAAAACAGAGAAGAGTTTGAGATGGTTTTCGATGGTGAGCCTGAGCACACAAATGTCTGTT
TC
TGGTACATTCCACAAAGCCTTCGAGGGGTTCCAGATAGCCCTGAGCGACGAGAAAAGCTACACAGGGT
G
GCTCCCAAGATCAAAGCTCTGATGATGGAGTCAGGAACAACCATGGTGGGCTACCAGCCTCAAGGGGAC
AAG
GCCAACTTCTTCCGGATGGTCATCTCTAACCCAGCCGCCACCCAGTCTGACATCGATTTCCTCATTG
AG
GAGATAGAGAGGTTGGGTCAGGATCTGTAA


Translation (593 aa):
MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFRERQ
S
SKNLLSCENSDQGARFRRTETDFSNLFAQ
DLLPAKNGEEQTAQFLLEVVDILLNYVRKTFDRSTKVLDF
H
HPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRT
GHPRFFNQLSTGLDIIGLAGEWLTSTANT
N
MFTYEIAPVFVLMEQITLKKMREIVGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPK
L
VLFTSEH
SHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGYVPLYVNATAGTTVYG
A
FDPIQEIADICEKYNLWLHVD
AAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
G
ILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAK
GTVGFENQINKCLELADYLY
A
KIKNREEFEMVFDGE
PEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGD
K
ANFFRMVISNPAATQSDIDFLIEEIERLGQDL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser