NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16090.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16090.1 Public Mus musculus 2 Abcb11 16 104 75 CCDS HistoryNCBI Gene:27413Re-query CCDS DB by CCDS ID:16090.1Re-query CCDS DB by GeneID:27413

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16090.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102709 ENSMUSP00000099770 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102709Link to Ensembl Protein Viewer:ENSMUSP00000099770Re-query CCDS DB by Nucleotide ID:ENSMUST00000102709Re-query CCDS DB by Protein ID:ENSMUSP00000099770
Original member Current member EBI,WTSI ENSMUST00000102710 ENSMUSP00000099771 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102710Link to Ensembl Protein Viewer:ENSMUSP00000099771Re-query CCDS DB by Nucleotide ID:ENSMUST00000102710Re-query CCDS DB by Protein ID:ENSMUSP00000099771
Original member Current member EBI,WTSI OTTMUST00000031268 OTTMUSP00000013989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031268Link to Vega Protein Viewer:OTTMUSP00000013989Re-query CCDS DB by Nucleotide ID:OTTMUST00000031268Re-query CCDS DB by Protein ID:OTTMUSP00000013989
Original member Current member EBI,WTSI OTTMUST00000031269 OTTMUSP00000013990 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031269Link to Vega Protein Viewer:OTTMUSP00000013990Re-query CCDS DB by Nucleotide ID:OTTMUST00000031269Re-query CCDS DB by Protein ID:OTTMUSP00000013990
Original member Current member NCBI NM_021022.3 NP_066302.2 Accepted alive Link to Nucleotide Sequence:NM_021022.3Link to Protein Sequence:NP_066302.2Re-query CCDS DB by Nucleotide ID:NM_021022Re-query CCDS DB by Protein ID:NP_066302Link to BLink:NP_066302.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_066302.2 1321 Q9QY30 1321 100% 0 0

Chromosomal Locations for CCDS 16090.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 69239084 69239284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69243415 69243561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69245745 69245951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69248714 69248911 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69257207 69257363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69259483 69259724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69261363 69261566 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69265385 69265546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69265638 69265742 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69273998 69274159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69277771 69277870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69282591 69282660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69284590 69284791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69285210 69285380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69286665 69286868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69287599 69287724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69289366 69289476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69291941 69292054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69296312 69296486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69299803 69299927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69303937 69304108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69306505 69306638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69308459 69308546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69323832 69324070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69325144 69325195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69327977 69327998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69329270 69329345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3966 nt):
ATGTCTGACTCAGTGATTCTTCGCAGTGTGAAGAAATTTGGAGAGGAGAATCATGCTTTCGAATCAGATG
GT
TTCCATAACAATGATAAGAAATCAAGGTTACAAGATAAGAAGAAAGGGGAAGGCGCTCGAGTTGGCTT
C
TTTGAACTGTTTCGATTTTCTTCATCAAAAGACAACTGGCTGATGTTTATGGGAAGTGTGTGCGCATTG
CTC
CATGGAATGGCCCAGCCAGGCATGATTATTGTGTTTGGTATACTGACAGATATTTTTGTTGAATATG
AC
ATTGAAAGACAAGAACTCAGTATTCCAGAAAAAGTGTGTATGAATAACACCATTGTATGGATCAACAG
C
TCCTTCAACCAGAACATGACAAACGGAACAAGCTGTGGGTTGGTGGACATTAACAGCGAAGTCATCAAA
TTT
TCTGGCATCTACGCAGGAGTTGGTGTGGCTGTCCTTATCCTAGGATACTTTCAAATAAGGTTGTGGG
TA
ATCACTGGGGCTCGTCAGATAAGGAAAATGAGGAAATTTTACTTTCGGAGAATAATGAGAATGGAAAT
C
GGATGGTTTGACTGCACTTCTGTGGGAGAGCTCAATTCAAGATTCTCTGATGATATTAATAAAATTGAT
GAA
GCCATTGCCGACCAGATGGCCCTTTTCCTTCAGCGCCTGTCGACAGCTTTGTCTGGGCTCCTTTTAG
GG
TTCTACAGGGGTTGGAAATTAACCTTGGTGATTCTCGCTGTCAGTCCTCTCATTGGGATTGGGGCAGC
C
GTCATAGGTCTGAGTGTGGCCAAGTTCACGGAGCTTGAGTTGAAGGCTTATGCTAAAGCTGGGTCTATT
GCC
GATGAAGTCCTCTCATCTATTCGAACAGTGGCTGCTTTTGGTGGTGAGAATAAGGAGGTGGAAAGGT
AT
GAGAAAAATCTTATGTTTGCTCAGCGCTGGGGAATTTGGAAAGGAATGGTGATGGGCTTCTTCACTGG
G
TACATGTGGTGTCTCATTTTCTTCTGTTATGCACTGGCCTTCTGGTACGGCTCCAGACTTGTCCTGGAT
GAA
GGCGAGTACACACCAGGGACACTGATCCAGATTTTCCTCTGTGTCATAATAGCAGCTATGAATATTG
GC
AATGCATCTTCTTGTTTGGAAATCTTCTCCACTGGGTGTTCAGCAGCTTCCAGTATTTTCCAAACAAT
A
GACAGGCAACCCGTCATGGACTGCATGTCAGGAGATGGTTACAAGCTAGATCGAATCAAGGGCGAAATT
GAG
TTCCACAATGTGACCTTCCATTATCCTTCTCGACCAGAGGTGAAGATTTTAAATAACCTCAGCATGG
TC
ATTAAGCCAGGGGAAACGACGGCGTTCGTGGGATCCAGTGGGGCAGGGAAGAGCACAGCACTACAGCT
C
ATTCAGAGATTCTATGACCCCTGCGAAGGCATGGTGACTCTGGATGGCCATGACATTCGTTCTCTTAAC
ATC
CGGTGGCTGAGAGATCAAATTGGGATCGTGGAACAGGAGCCAGTTCTGTTCTCCACCACTATCGCAG
AA
AACATCCGCCTTGGTAGAGAAGAGGCGACAATGGAAGACATAGTCCAAGCTGCCAAGGATGCTAATGC
A
TACAACTTCATTATGGCCCTGCCACAGCAATTTGACACCCTAGTTGGAGAAGGAGGAGGCCAGATGAGT
GGT
GGGCAGAAGCAAAGGGTAGCCATCGCCCGCGCCCTCATACGGAAACCCAAGATCCTGCTTCTGGACA
TG
GCTACCTCAGCACTGGACAATGAGAGTGAGGCCAAAGTACAGGGAGCACTGAATAAGATCCAACATGG
A
CACACAATCATCTCAGTTGCCCATCGCCTATCAACAGTCAGATCTGCAGATGTGATCATTGGCTTTGAG
CAT
GGAACAGCTGTGGAAAGAGGCACCCATGAAGAACTGTTAGAAAGAAAAGGTGTCTACTTCATGCTTG
TG
ACCCTGCAAAGCCAAGAAGATAATACTCACAAAGAAACAGGCATAAAGGGAAAAGATACAACCGAAGG
G
GACACACCTGAGAGGACCTTTTCCAGAGGCAGCTATCAGGACAGTTTAAGAGCTTCCATCCGTCAACGA
TCT
AAGTCTCAGCTGTCTCATCTGTCACATGAACCTCCACTGGCTATAGGTGATCACAAGTCCTCTTACG
AA
GACAGAAAGGACAATGATGTGCTTGTGGAAGAAGTTGAACCTGCCCCAGTTAGGAGGATTCTAAAATA
C
AACATCTCAGAATGGCCCTACATACTGGTAGGGGCTTTGTGTGCAGCCATTAATGGGGCAGTCACACCC
ATC
TACTCCCTTTTATTCAGCCAGATCCTTAAGACTTTTTCACTCGTTGATAAAGAACAACAAAGGTCAG
AG
ATTTACAGCATGTGCCTGTTTTTTGTCATCCTGGGCTGTGTATCACTTTTCACACAATTTCTGCAGGG
T
TACAATTTTGCCAAATCTGGAGAGCTCCTCACAAAAAGGCTGCGTAAATTTGGTTTCAAGGCAATGTTA
AGA
CAAGATATTGGCTGGTTCGATGACCTCAAAAATAATCCTGGAGTACTAACAACTAGGCTTGCTACAG
AT
GCTTCCCAAGTTCAAGGGGCTACTGGCTCTCAAGTTGGGATGATGGTCAATTCCTTCACTAACATCTT
T
GTGGCCGTGCTCATCGCCTTCCTCTTTAACTGGAAGCTCAGTCTGGTTATATCAGTCTTCTTCCCCTTT
TTG
GCTTTATCGGGAGCTGTACAGACAAAAATGCTGACAGGATTCGCTTCTCAAGACAAGGAAATTCTGG
AG
AAGGCTGGCCAGATCACCAACGAAGCCCTTAGCAATATCCGCACCGTGGCTGGAATTGGAGTGGAGGG
A
AGATTTATTAAAGCATTTGAGGTTGAGCTGGAGAAGTCATACAAGACTGCCATTAGAAAGGCAAATGTC
TAT
GGCCTCTGCTATGCCTTTTCCCAGGGGATATCATTTCTTGCCAATTCTGCAGCCTATAGATATGGAG
GT
TACTTAATAGTCTACGAAGATCTGAACTTCAGCTATGTTTTCAGGGTGGTCTCTTCCATTGCAATGAG
C
GCAACGGCTGTTGGAAGAACATTCTCTTACACACCGAGCTATGCCAAAGCTAAAATATCAGCTGCACGC
TTT
TTTCAACTGCTAGACAGAAAACCTCCAATTGATGTGTACAGTGGAGCAGGTGAAAAATGGGACAACT
TC
CAAGGGAAGATTGATTTTATCGACTGTAAATTTACATATCCTTCTCGACCTGATATACAAGTTCTGAA
T
GGACTGTCGGTATCTGTGGATCCTGGGCAGACGCTGGCATTCGTTGGGAGCAGTGGGTGTGGTAAAAGC
ACC
AGCATCCAGCTGTTGGAACGGTTCTACGATCCCGATCAGGGAACGGTGATGATAGATGGTCACGACA
GC
AAAAAAGTCAATGTTCAGTTCCTCCGTTCAAACATTGGGATTGTCTCCCAGGAGCCCGTGTTATTTGA
C
TGTAGCATAATGGACAACATCAAGTATGGGGACAACACCAAAGAGATCTCCGTGGAGAGAGCTATAGCT
GCC
GCAAAGCAGGCTCAGCTGCATGACTTCGTCATGTCACTCCCAGAGAAATATGAAACTAATGTTGGGA
TC
CAGGGCTCTCAACTCTCTCGCGGGGAGAAACAACGCATTGCTATTGCTCGGGCCATTGTACGAGATCC
T
AAAATCTTGCTACTGGATGAAGCTACATCTGCCTTAGACACAGAAAGTGAAAAGACAGTGCAGCTTGCT
CTG
GACAAAGCCAGAGAGGGTCGGACCTGTATTGTCATTGCTCATCGCTTGTCTACTATCCAGAACTCAG
AT
ATCATCGCCGTCATGTCACAAGGAGTGGTGATTGAAAAGGGGACCCATAAGAAACTGATGGACCAGAA
G
GGGGCCTACTACAAGCTGGTCATCACTGGAGCCCCCATCAGTTGA


Translation (1321 aa):
MSDSVILRSVKKFGEENHAFESDGFHNNDKKSRLQDKKKGEGARVGFFELFRFSSSKDNWLMFMGSVCAL
L
HGMAQPGMIIVFGILTDIFVEYDIERQELSIPEKVCMNNTIVWINSSFNQNMTNGTSC
GLVDINSEVIK
F
SGIYAGVGVAVLILGYFQ
IRLWVITGARQIRKMRKFYFRRIMRMEIGWFDCTSVGELNSRFSDDINKID
E
AIADQMALFLQRLSTALSGLLLGFYRGWKLTLVILAVSPLIGIGAAVIGL
SVAKFTELELKAYAKAGSI
A
DEVLSSIRTVAAFGGENKEVE
RYEKNLMFAQRWGIWKGMVMGFFTGYMWCLIFFCYALAFWYGSRLVLD
E
GEYTPGTLIQ
IFLCVIIAAMNIGNASSCLEIFSTGCSAASSIFQTIDRQPVMDCMSGDGYKLDRIKGEI
E
FHNVTFHYPSRPEVK
ILNNLSMVIKPGETTAFVGSSGAGKSTALQLIQRFYDPCEGMVTLDGHDIRSLN
I
RWLRDQIGIVEQEPVLFSTTIAENIRLGREEATMEDIVQAAKDANAYNFIMALPQ
QFDTLVGEGGGQMS
G
GQKQRVAIARALIRKPKILLLDMATSALDNESEAKVQGALNK
IQHGHTIISVAHRLSTVRSADVIIGFE
H
GTAVERGTHEELLERKGVYFMLVTLQSQEDNTHKETGIK
GKDTTEGDTPERTFSRGSYQDSLRASIRQR
S
KSQLSHLSHEPPLAIGDHKSSYEDRK
DNDVLVEEVEPAPVRRILKYNISEWPYILVGALCAAINGAVTP
I
YSLLFSQILK
TFSLVDKEQQRSEIYSMCLFFVILGCVSLFTQFLQGYNFAKSGELLTKRLRKFGFKAML
R
QDIGWFDDLKNNPGVLTTRLATDASQVQG
ATGSQVGMMVNSFTNIFVAVLIAFLFNWKLSLVISVFFPF
L
ALSGAVQTKMLTGFASQDKEILEKAGQ
ITNEALSNIRTVAGIGVEGRFIKAFEVELEKSYKTAIRKANV
Y
GLCYAFSQGISFLANSAAYRYGGYLIVYEDLNFSYVF
RVVSSIAMSATAVGRTFSYTPSYAKAKISAAR
F
FQLLDRKPPIDVYSGAGEKW
DNFQGKIDFIDCKFTYPSRPDIQVLNGLSVSVDPGQTLAFVGSSGCGKS
T
SIQLLERFYDPDQGTV
MIDGHDSKKVNVQFLRSNIGIVSQEPVLFDCSIMDNIKYGDNTKEISVERAIA
A
AKQAQLHDFVMSLPE
KYETNVGIQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQLA
L
DKAREGRTCIVIAHRLSTIQNSDIIAVMSQGVVIEKGTHKKLMDQKGAYYKLVITGAPIS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser