NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15432.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15432.1 Public Mus musculus 1 Sele 16 104 75 CCDS HistoryNCBI Gene:20339Re-query CCDS DB by CCDS ID:15432.1Re-query CCDS DB by GeneID:20339See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15432.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027874 ENSMUSP00000027874 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027874Link to Ensembl Protein Viewer:ENSMUSP00000027874Re-query CCDS DB by Nucleotide ID:ENSMUST00000027874Re-query CCDS DB by Protein ID:ENSMUSP00000027874
Original member Current member NCBI NM_011345.2 NP_035475.1 Accepted alive Link to Nucleotide Sequence:NM_011345.2Link to Protein Sequence:NP_035475.1Re-query CCDS DB by Nucleotide ID:NM_011345Re-query CCDS DB by Protein ID:NP_035475Link to BLink:NP_035475.1

Chromosomal Locations for CCDS 15432.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 164048686 164048743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164049215 164049598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164050080 164050187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164050644 164050832 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164051537 164051722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164051825 164052013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164052965 164053153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164053536 164053724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164053818 164053994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164054617 164054727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164055554 164055575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 164055677 164055734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGAAAGCAACTGCTGGAGTCATGAATGCCTCGCGCTTTCTCTCTGCTCTTGTTTTTGTTCTCCTCGCTG
GA
GAGAGCACAGCTTGGTACTACAATGCCTCCAGTGAGCTCATGACGTATGATGAAGCCAGTGCATACTG
T
CAGCGGGACTACACACATCTGGTGGCAATTCAGAACAAGGAAGAGATCAACTACCTTAACTCCAATCTG
AAA
CATTCACCGAGTTACTACTGGATTGGAATCAGAAAAGTCAATAACGTATGGATCTGGGTGGGGACGG
GG
AAGCCTCTGACAGAGGAAGCTCAGAACTGGGCTCCAGGTGAACCAAACAACAAACAAAGAAATGAGGA
C
TGTGTAGAGATTTACATCCAACGAACCAAAGACTCGGGCATGTGGAATGACGAGAGATGTAACAAAAAG
AAG
CTGGCTCTGTGCTACACAGCTTCGTGTACCAATGCATCCTGCAGTGGTCATGGTGAATGCATAGAGA
CC
ATCAATAGTTACACCTGCAAGTGCCACCCTGGCTTCCTGGGACCCAACTGTGAGCAAGCTGTGACTTG
C
AAACCACAGGAACACCCTGACTATGGAAGCCTGAACTGCTCCCACCCGTTCGGCCCCTTCAGCTATAAT
TCC
TCCTGCTCCTTTGGCTGTAAAAGGGGCTACCTGCCCAGCAGCATGGAGACCACCGTGCGGTGTACGT
CC
TCTGGAGAGTGGAGTGCGCCTGCTCCAGCCTGCCATGTGGTTGAATGTGAAGCTTTGACCCACCCTGC
C
CACGGTATCAGGAAATGTTCCTCAAATCCTGGGAGCTACCCATGGAACACGACATGCACGTTTGACTGT
GTG
GAAGGGTACAGGCGAGTTGGAGCTCAGAATCTACAGTGTACCTCATCTGGCATCTGGGATAACGAGA
CG
CCATCATGCAAAGCTGTGACCTGTGACGCCATCCCTCAGCCTCAGAATGGCTTTGTGAGCTGCAGCCA
C
TCAACAGCTGGAGAACTTGCGTTTAAGTCATCCTGTAACTTCACCTGTGAGCAGAGTTTCACGTTGCAG
GGG
CCAGCGCAGGTTGAATGCAGCGCACAAGGGCAGTGGACACCACAAATCCCAGTCTGCAAAGCTGTCC
AG
TGTGAAGCCTTATCTGCGCCACAGCAGGGCAACATGAAATGTCTTCCCAGTGCTTCTGGACCTTTCCA
A
AATGGGTCCAGTTGTGAGTTCTCCTGCGAAGAAGGATTTGAACTGAAGGGATCAAGAAGACTTCAGTGT
GGT
CCAAGAGGGGAATGGGATAGCAAGAAGCCCACGTGTTCAGCTGTGAAATGTGATGATGTCCCTCGGC
CC
CAGAATGGCGTCATGGAGTGTGCTCATGCTACTACTGGAGAATTCACCTACAAGTCCTCATGTGCCTT
T
CAATGCAATGAGGGCTTTAGCTTGCATGGCTCAGCTCAACTTGAGTGCACATCTCAGGGAAAGTGGACC
CAG
GAAGTCCCCTCCTGCCAAGTGGTACAATGTCCAAGCCTTGACGTCCCGGGAAAGATGAACATGAGCT
GC
AGCGGAACAGCAGTTTTCGGCACAGTGTGTGAGTTTACATGTCCTGATGATTGGACACTCAATGGATC
T
GCAGTTCTGACGTGTGGTGCCACGGGACGCTGGTCTGGGATGCCGCCTACCTGTGAAGCCCCAGTCAGC
CCC
ACCCGTCCCTTGGTAGTTGCACTTTCTGCGGCAGGAACCTCACTCCTGACATCGTCCTCATTGCTCT
AC
TTGTTGATGAGATACTTTCGGAAGAAAGCAAAGAAATTTGTTCCTGCTAGCAGCTGCCAAAGCCTTCA
A
TCGTTTGAAAACTACCATGTGCCTTCTTACAACGTCTAG


Translation (619 aa):
MKATAGVMNASRFLSALVFVLLAGESTAWYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSNL
K
HSPSYYWIGIRKVNNVWIWVGTGKPLTEEAQNWAPGEPNNKQRNEDCVEIYIQRTKDSGMWNDERCNKK
K
LALCYT
ASCTNASCSGHGECIETINSYTCKCHPGFLGPNCEQAVTCKPQEHPDYGSLNCSHPFGPFSYN
S
SCSFGCKRGYLPSSMETTVRCTSSGEWSAPAPACH
VVECEALTHPAHGIRKCSSNPGSYPWNTTCTFDC
V
EGYRRVGAQNLQCTSSGIWDNETPSCK
AVTCDAIPQPQNGFVSCSHSTAGELAFKSSCNFTCEQSFTLQ
G
PAQVECSAQGQWTPQIPVCK
AVQCEALSAPQQGNMKCLPSASGPFQNGSSCEFSCEEGFELKGSRRLQC
G
PRGEWDSKKPTCS
AVKCDDVPRPQNGVMECAHATTGEFTYKSSCAFQCNEGFSLHGSAQLECTSQGKWT
Q
EVPSCQ
VVQCPSLDVPGKMNMSCSGTAVFGTVCEFTCPDDWTLNGSAVLTCGATGRWSGMPPTCEAPVS
P
TRPLVVALSAAGTSLLTSSSLLYLLMRYFRKK
AKKFVPASSCQSLQSFENYHVPSYNV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser