NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15295.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15295.1 Public Mus musculus 1 Ren1 16 104 75 CCDS HistoryNCBI Gene:19701Re-query CCDS DB by CCDS ID:15295.1Re-query CCDS DB by GeneID:19701

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15295.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094556 ENSMUSP00000092135 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094556Link to Ensembl Protein Viewer:ENSMUSP00000092135Re-query CCDS DB by Nucleotide ID:ENSMUST00000094556Re-query CCDS DB by Protein ID:ENSMUSP00000092135
Original member Current member EBI,WTSI OTTMUST00000051330 OTTMUSP00000024128 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051330Link to Vega Protein Viewer:OTTMUSP00000024128Re-query CCDS DB by Nucleotide ID:OTTMUST00000051330Re-query CCDS DB by Protein ID:OTTMUSP00000024128
Original member Current member NCBI NM_031192.3 NP_112469.1 Accepted alive Link to Nucleotide Sequence:NM_031192.3Link to Protein Sequence:NP_112469.1Re-query CCDS DB by Nucleotide ID:NM_031192Re-query CCDS DB by Protein ID:NP_112469Link to BLink:NP_112469.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_112469.1 402 P06281 402 100% 0 0

Chromosomal Locations for CCDS 15295.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 133350706 133350797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133354127 133354277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133354802 133354925 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133355495 133355613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133356385 133356581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133358404 133358523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133358938 133359082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133359334 133359432 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 133359977 133360138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1209 nt):
ATGGACAGAAGGAGGATGCCTCTCTGGGCACTCTTGTTGCTCTGGAGTCCTTGCACCTTCAGTCTCCCAA
CA
CGCACCGCTACCTTTGAACGAATCCCGCTCAAGAAAATGCCTTCTGTCCGGGAAATCCTGGAGGAGCG
G
GGAGTGGACATGACCAGGCTCAGTGCTGAATGGGGCGTATTCACAAAGAGGCCTTCCTTGACCAATCTT
ACC
TCCCCCGTGGTCCTCACCAACTACCTGAATACCCAGTACTACGGCGAGATTGGCATCGGTACCCCAC
CC
CAGACCTTCAAAGTCATCTTTGACACGGGTTCAGCCAACCTCTGGGTGCCCTCCACCAAGTGCAGCCG
C
CTCTACCTTGCTTGTGGGATTCACAGCCTCTATGAGTCCTCTGACTCCTCCAGCTACATGGAGAACGGG
TCC
GACTTCACCATCCACTACGGATCAGGGAGAGTCAAAGGTTTCCTCAGCCAGGACTCGGTGACTGTGG
GT
GGAATCACTGTGACACAGACCTTTGGAGAGGTCACCGAGCTGCCCCTGATCCCTTTCATGCTGGCCAA
G
TTTGACGGTGTTCTAGGCATGGGCTTTCCCGCTCAGGCCGTTGGCGGGGTTACCCCTGTCTTTGACCAC
ATT
CTCTCCCAGGGGGTGCTAAAGGAGGAAGTGTTCTCTGTCTACTACAACAGGGGTTCCCACCTGCTGG
GG
GGCGAGGTGGTGCTAGGAGGTAGCGACCCGCAGCATTATCAAGGCAATTTTCACTATGTGAGCATCAG
C
AAGACTGACTCCTGGCAGATCACGATGAAGGGGGTGTCTGTGGGGTCTTCCACCCTGCTATGTGAAGAA
GGC
TGTGCGGTAGTGGTGGACACTGGTTCATCCTTTATCTCGGCTCCTACGAGCTCCCTGAAGTTGATCA
TG
CAAGCCCTGGGAGCCAAGGAGAAGAGAATAGAAGAATATGTTGTGAACTGTAGCCAGGTGCCCACCCT
C
CCCGACATTTCCTTTGACCTGGGAGGCAGGGCCTACACACTCAGCAGTACGGACTACGTGCTACAGTAT
CCC
AACAGGAGAGACAAGCTGTGCACACTGGCTCTCCATGCCATGGACATCCCACCACCCACTGGGCCTG
TC
TGGGTCCTGGGTGCCACCTTCATCCGCAAGTTCTATACAGAGTTTGATCGGCATAACAATCGCATTGG
A
TTCGCCTTGGCCCGCTAA


Translation (402 aa):
MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNL
T
SPVVLTNYLN
TQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENG
S
DFTIHYGSGRVKGFLSQDSVT
VGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDH
I
LSQGVLKEEVFSVYYN
RGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEE
G
CAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEE
YVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQY
P
NRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser