NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15101.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15101.1 Public Mus musculus 1 Slc19a3 16 104 75 CCDS HistoryNCBI Gene:80721Re-query CCDS DB by CCDS ID:15101.1Re-query CCDS DB by GeneID:80721See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15101.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000045560 ENSMUSP00000041683 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000045560Link to Ensembl Protein Viewer:ENSMUSP00000041683Re-query CCDS DB by Nucleotide ID:ENSMUST00000045560Re-query CCDS DB by Protein ID:ENSMUSP00000041683
Original member Current member EBI,WTSI ENSMUST00000164473 ENSMUSP00000126646 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164473Link to Ensembl Protein Viewer:ENSMUSP00000126646Re-query CCDS DB by Nucleotide ID:ENSMUST00000164473Re-query CCDS DB by Protein ID:ENSMUSP00000126646
Original member Current member EBI,WTSI OTTMUST00000054192 OTTMUSP00000025828 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054192Link to Vega Protein Viewer:OTTMUSP00000025828Re-query CCDS DB by Nucleotide ID:OTTMUST00000054192Re-query CCDS DB by Protein ID:OTTMUSP00000025828
Original member Current member NCBI NM_030556.2 NP_085033.2 Accepted alive Link to Nucleotide Sequence:NM_030556.2Link to Protein Sequence:NP_085033.2Re-query CCDS DB by Nucleotide ID:NM_030556Re-query CCDS DB by Protein ID:NP_085033Link to BLink:NP_085033.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_085033.2 488 Q99PL8 488 100% 0 0

Chromosomal Locations for CCDS 15101.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 83013819 83013989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 83014703 83014844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 83019332 83019524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 83022334 83023141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 83026226 83026378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1467 nt):
ATGGACTCCAGCTGCAGAACTCCACCGAGCAACTCTTGGGTTTATCCCACTGTGATACTCTGCTTGTTTG
GG
TTTTTCTCCATGTTCAGGCCTTCAGAGGCATTCTTAATCCCATTCCTGTCAGAACCCAGCAAGAATCT
C
ACCAGCCCAGAGATGACAAATGAGATCCTTCCTGTTTGGACATATTCTTACCTGGCAACGCTGCCACCC
GTG
TTTGTCCTCACCGACTACCTGCGCTACAAACCAGTCATCATGCTACACGTTGTGGCCTTCGCCACTA
GC
TACCTGTTTCTCTTGTTTGGCCAAGGTGTGATGCTCATGCAAACAGCTGAGTTCTTTTTTGGGGTTGT
C
TCGGCCACAGAGATAGCCTACTTTGCCTACATATACAGCATGGTCAGCCCAGAACACTATCAGAAAGTG
AGC
AGCTACTGTCGGAGTATCACACTGGTGGCCTACACAGCAGGCTCAGTGTTAGCCCAGCTCCTGGTAT
CC
CTGACGAACCTGCCATACTCTAGCCTTTTTTATATATCCTTGGCCTGTGTCTCTGTGGCTTTCTTTTT
C
TCACTTTTTCTACCAATGCCTAAGAAGAGCATGTTTTTCCATGCAAAGTCCGATAGAGACGATTGTCCA
AAG
CCACTGGAACAATGTACTGTGCCCAAGGAAGCCCAGAGCAACAGAACTCACTCAGAATTGTTTGCCA
AT
TCAAAGAATCTAGAGGACAGAGAGATGAGCAACCCAGATCCAGAAAATTCAGCTTTGAGACACTTTGC
G
CATTGGTTCCAGGATCTGAAGGAGTGCTACTCCTCAAAGCACCTTGTTTACTGGTCCCTCTGGTGGGCT
TTT
GCCACAGCAGGTTATAACCAAATCTTGAACTATGTTCAAGTCCTATGGGAACACAAGGCACCCTCCC
AA
GATTCTTCCATCTATAATGGAGCAGTAGAGGCCATAGCAACATTTGGAGGAGCTTTGGCTTCATTCTC
A
GTGGGCTATCTGAAGGTCAACTGGGATCTTCTCGGAGAGCTGGGTCTGGCTGTCTTCTCAGCTGTCATC
GCA
GGATCTCTGTTTCTCATGAATTACTCACGCAGCATCTGGGTGTGCTATGCTGGGTATCTACTGGTCA
AG
TCGAGCTATTCGTTTCTTATAACCATCGCAGTCTTTCAGATTGCAGTTAACCTGAGCTTAGAACGTTA
T
GCCCTGGTGTTCGGCATAGACACCTTTATCGCCTTGGTGATTCAGACCATCATGACTATGATTGTGGTA
GAT
CAAAGAGGGCTCCAACTGCCAGTCACTACTCAGTTTTTAGTTTATGGGAGTTACTTCGCTGTCATTG
CG
GGGGTCTTCCTAATGAGAAGCATATACATTCTCTGCTCAGCTAAGTGCCGAAAGGAAGTACAGAACCT
T
GCTACCACCCGGAGCCCTAATGAGCCACACCCACAAGAGCCAAGCAATGTGTCAACAAAGTTCTAA


Translation (488 aa):
MDSSCRTPPSNSWVYPTVILCLFGFFSMFRPSEAFLIPFLSEPSKNLTSPEMTNEILPVWTYSYLATLPP
V
FVLTDYLRYKPVIMLHVVAFATSYLFLLFGQGVMLMQTAEFFFGVVSATEIAYFAYIYSMVSPEHYQKV
S
SYCRSITLVAYTAGSVLAQLLVSLTNLPYSSLFYISLACVSVAFFFSLFLPMPKKSMFFHAKSDRDDCP
K
PLEQCTVPKEAQSNRTHSELFANSKNLEDREMSNPDPENSALRHFAHWFQDLKECYSSKHLVYWSLWWA
F
ATAGYNQILNYVQVLWEHKAPSQDSSIYNGAVEAIATFG
GALASFSVGYLKVNWDLLGELGLAVFSAVI
A
GSLFLMNYSRSIWVCYAGYLLVKSSYSFLITIA
VFQIAVNLSLERYALVFGIDTFIALVIQTIMTMIVV
D
QRGLQLPVTTQ
FLVYGSYFAVIAGVFLMRSIYILCSAKCRKEVQNLATTRSPNEPHPQEPSNVSTKF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser