Chemical name:18F-Labeled N-(4-fluorobenzylidene)oxime-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC
Abbreviated name:18F-FBO-MUT-DS
Synonym:
Agent Category:Affibody, antibody
Target:HER2
Target Category:Receptor
Method of detection:Positron emission tomography (PET)
Source of signal / contrast:18F
Activation:No
Studies:
  • Checkbox In vitro
  • Checkbox Rodents
Structure is not available.

From: 18F-Labeled N-(4-fluorobenzylidene)oxime-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC

Cover of Molecular Imaging and Contrast Agent Database (MICAD)
Molecular Imaging and Contrast Agent Database (MICAD) [Internet].

NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health.