NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.

Cover of Molecular Imaging and Contrast Agent Database (MICAD)

Molecular Imaging and Contrast Agent Database (MICAD) [Internet].

Show details

68Ga

67/68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-1,2-diaminoethane-γ-folate

68Ga-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Cpa-cyclo(d-Cys-amino-Phe-hydroorotic acid-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)-D-Tyr-NH2 (JR11)

68Ga-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH2

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-aminohexanoic acid-Lys40-exendin-4

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-cyclo(Arg-Gly-Asp-D-Phe-Lys)

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Epidermal growth factor

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Gly-Gly-Gly-Gly-Lys-Gly-Gly-Gly-Gly

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-HER2-specific Affibody ZHER2:2891

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Lys40-exendin-3

68Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-synthetic HER2 specific Affibody ZHER2:342-pep2

68Ga-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-1,4,7,10-tetraacetic acid-rhenium-cyclized-[Cys3,4,10,D-Phe7,Arg11]α-MSH3-13

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-1,2-diaminoethane-γ-5,8-dideazfolic acid (P3238)

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-1,2-diaminoethane-γ-folate (P3246)

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Asp-cyclohexylalanine-Phe-d-Ser-d-Arg-Tyr-Leu-Trp-Ser-NH2 (AE105-NH2)

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Cpa-cyclo(d-Cys-amino-Phe-hydroorotic acid-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)-D-Tyr-NH2 (JR11)

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-cyclo(Arg-Gly-Asp-d-Phe-Lys)

68Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH2

68Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-2-nitroimidazole-N-ethylamine

68Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-c(RGDfK)-human serum albumin-tissue inhibitor of matrix metalloproteinase 2 fusion protein

68Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-c(RGDyK)-S-S-CPLHSpT

68Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-p-isothiocyanatobenzyl-vascular endothelial growth factor-121

68Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-polyethylene glycol-single-chain Cys-tagged vascular endothelial growth factor-121

68Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[15-amino-4,7,10,13-tetraoxapentadecanoic acid-c(Arg-Gly-Asp-D-Phe-Lys)]2

68Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[c(Arg-Gly-Asp-D-Tyr-Lys)]2

68Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[Gly-Gly-Gly-c(Arg-Gly-Asp-D-Phe-Lys)]2

68Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-c(RGDyK)-bombesin[7-14]

68Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-isothiocyanatobenzyl-c(Arg-Gly-Asp-d-Tyr-Lys)

68Ga-1,4,7-Triazacyclononane-1,4-diacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2

68Ga-CHX-A”-Rhenium-cyclized-[Cys3,4,10,D-Phe7,Arg11]α-MSH3-13

68Ga-Desferrioxamine p-isothiocyanatobenzyl-anti-EGFR nanobody 7D12

68Ga-DOTA-4-amino-1-carboxymethyl-piperidine-D-Phe-Gln-Trp-Ala-Val-Gly-His-Sta-Leu-NH2

68Ga-Glutamate peptide-3 aminoethyl estradiol

68Ga-Isothiocyanatobenzyl-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-2-(2-nitroimidazolyl)ethylamine

68Ga-Labeled (1,4,7,10-tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid)-1-NaI3-octreotide

68Ga-Labeled (4-{[(bis(phosphonomethyl))carbamoyl]methyl}-7,10-bis(carboxymethyl)-1,4,7,10-tetraazacyclododec-1-yl)acetic acid (BPAMD)

68Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-Tyr-cyclo(DAB-Arg-cyclo(Cys-Phe-d-Trp-Lys-Thr-Cys))

68Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC

68Ga-Labeled 2-[3-(1-carboxy-5-{7-[5-carboxy-5-(3-phenyl-2-{3-phenyl-2-[2-(4,7,10-tris-carboxymethyl-1,4,7,10-tetraazacyclododec-1-l)acetylamino]propionylamino}propionylamino)pentylcarbamoyl]heptanoylamino}pentyl)ureido]pentanedioic acid

68Ga-Labeled 2-[4,7-di(carboxymethyl)-1,4,7-triazonan-1-yl]-5-[(4-hydroxy-4,4-diphosphonobutyl)amino]-5-oxopentanoic acid (NOTA-bisphosphonate (BP))

68Ga-Labeled 2-{3-[5-(7-{1-benzyloxycarbonyl-5-[2-(4,7,10-tris-carboxymethyl-1,4,7,10-tetraazacyclododec-1-l)acetylamino]pentylcarbamoyl}-heptanoylamino)-1-carboxypentyl]ureido}pentanedioic acid

68Ga-Labeled alanine derivatives of 1,4,7,10-tetraazacyclododecane-1,7-diacetic acid and 1,4,7,10-tetraazacyclododecane-1,4,7,-triacetic acid

68Ga-Labeled anti-EpCAM diabody against epithelial cell adhesion molecule

68Ga-Labeled DOTA-conjugated sCCK8[Phe2(p-CH2SO3H),Nle3,6], a sulfated cholecystokinin 8 (sCCK8) peptide derivative

68Ga-Labeled homoalanine derivatives of 1,4,7,10-tetraazacyclododecane-1,7-diacetic acid and 1,4,7,10-tetraazacyclododecane-1,4,7,-triacetic acid

68Ga-Labeled NODAGA-conjugated ghrelin receptor agonists and inverse agonists

68Ga-Labeled β-aminoalanine, γ-aminohomoalanine, and ε-aminolysine conjugates of 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid

68Ga-Labeled β-aminoalanine, γ-aminohomoalanine, and ε-aminolysine conjugates of 1,4,7-triazacyclononane-1,4,7-triacetic acid

68Ga-N,N’-bis[2-Hydroxy-5-(carboxyethyl)benzyl]ethylenediamine-N,N’-diacetic acid-polyethylene glycol-single-chain Cys-tagged vascular endothelial growth factor-121

68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-2-(2-nitroimidazolyl)ethylamine

68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]2

68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-{Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]2}2

68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-cyclo(Arg-Gly-Asp-D-Phe-Lys)

68Ga-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-d-Glu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2

68Ga-Trastuzumab F(ab’) fragment

Gallium-68-dotamaleimide-Cys165-annexin A5

Gallium-68-dotamaleimide-Cys2-annexin A5

Gly-Ala-Cys-Leu-Arg-Ser-Gly-Arg-Gly-Cys-Gly-(PEG)3-DOTA-68Ga

PubReader format: click here to try

Views

Search MICAD

Limit my Search:


Recent Activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...