NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.

Cover of Molecular Imaging and Contrast Agent Database (MICAD)

Molecular Imaging and Contrast Agent Database (MICAD) [Internet].

Show details

18F

(-)-7-Methyl-2-exo-[3'-(6-[18F]fluoropyridin-2-yl)-5'-pyridinyl]-7-azabicyclo[2.2.1]heptane

(+)-2-Hydroxy-3-isobutyl-9-(3-[18F]fluoropropoxy)-10-methoxy-1,2,3,4,6,7-hexahydro-11bH-benzo[a]quinolizine

(1R,2S,3S,5S)-Methyl-8-{[(1S,2S)-2-([18F]fluoromethyl)cyclopropyl]methyl}-3-phenyl-8-azabicyclo[3.2.1]octane-2-carboxylate

(20R)-4,5-α-Epoxy-6-(2-[18F])fluoroethoxy)-3-hydroxy-α,17-dimethyl-α-(2-phenyleth-1-yl)-6,14-ethenomorphinan-7-methanol

(3R,5R)-5-(3-(2-[18F]Fluoroethoxy)phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one

(3R,5R)-5-(3-[18F]Fluoromethoxy-d2)phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one

(3R,5R)-5-(3-[18F]Fluoromethoxy-phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one

(4S)-4-(3-[18F]Fluoropropyl)-l-glutamate

(E)-2-(2-(2-(2-[18F]Fluoroethoxy)ethoxy)ethoxy)-5-(4-dimethylaminostyryl)-pyridine

(E)-3-(4-(Dimethylamino)phenyl)-1-(4-(2-(([18F]fluoroethoxy)ethoxy)ethoxy)phenyl)-2-propen-1-one

(E)-3-(Pyridin-2-ylethynyl)-cyclohex-2-enone-O-2-(2-[18F]fluoroethoxy)ethyl oxime

(E)-4-(2-(6-(2-(2-(2-([18F]-fluoroethoxy)ethoxy)ethoxy)pyridin-3-yl)vinyl)-N-methylbenzenamine

(R,S)-2-(N-Propyl-N-5'-[18F]fluoropentyl)amino-5-hydroxytetralin

(R,S)-anti-1-Amino-2-[18F]fluorocyclopentyl-1-carboxylic acid

(R)-2-(N-Benzyl-4-(2-[18F]fluoroethoxy)phenylsulfonamido)-N-hydroxy-3-methylbutanamide

(R)-2-Amino-3-[18F]fluoro-2-methylpropanoic acid

(R)-3-[18F]Fluoro-2-methyl-2-N-(methylamino)propanoic acid

(S,S)-2-(α-(2-[18F]Fluoro[2H2]methoxyphenoxy)phenoxy)benzyl)morpholine

(S,S)-2-[α-(2-(2-[18F]Fluoro[2H4]ethoxy)phenoxy)benzyl]morpholine

(S,S)-2-[α-(2-(2-[18F]Fluoroethoxy)phenoxy)benzyl]morpholine

(S)-1-((1-(2-[18F]Fluoroethyl)-1H-[1,2,3]-triazol-4-yl)methyl)-5-(2-4-difluorophenoxymethyl-pyrrolidine-1-sulfonyl)isatin

(S)-1-(4-(2-[18F]Fluoroethoxy)benzyl)-5-[1-(2-methoxymethyl-pyrrolidinyl)sulfonyl]-1H-indole-2,3-dione

(S)-2-Amino-3-[1-(2-[18F]fluoroethyl)-1H-[1,2,3]triazol-4-yl]propanoic acid

(S)-N-((1-Allyl-2-pyrrolidinyl)methyl)-5-(3-[18F]fluoropropyl)-2,3-dimethoxybenzamide

(S)-N-((1-Allyl-2-pyrrolidinyl)methyl)-5-(3-[18F]fluoropropyl)-2-methoxybenzamide

[18F]1-(2-Fluoroethyl)-4-[(4-cyanophenoxy)methyl]piperidine

[18F]1-(3-Fluoropropyl)-4-[(4-cyanophenoxy)methyl]piperidine[18F]FPS

[18F]-2-(2-Nitroimidazol-1H-yl)-(3,3,3-trifluoropropyl)acetamide

[18F]3-(1H-Imidazol-4-yl)propyl-4-fluorobenzyl ether

[18F]3-Fluoro-5-[(2-methyl-1,3-thiazol-4-yl)ethynyl]benzonitrile

[18F]3-Fluoro-5-[(pyridin-3-yl)ethynyl]benzonitrile

[18F]-5-(2-fluoroethyl)2,4-diethyl-3-(ethylsulfanylcarbonyl)-6-phenylpyridine-5-carboxylate

[18F]5-(6-Fluorohexyn-1-yl)-3-[2(S)-2-azetidinylmethoxy]pyridine

[18F]6-(2-Fluoropropyl)-4-methyl-pyridin-2-amine

[18F]6-fluoro-3-O-methyl-L-3,4-dihydroxyphenylalanine

[18F]FB-(Ac-NIe-Asp-His-d-Phe-Arg-Trp-Gly-Lys-NH2)

[18F]FB-NH-mini-PEG-E{E[c(RGDyK)]2}2

[18F]Fluoro-[1,2-2H4]choline

[18F]Fluoro-2-deoxy-2-D-glucose

[18F]-Fluoro-2-deoxy-d-glucose-folate

[18F]Fluorobenzaldehyde-leptin

[18F]Fluorobenzoyl-((VHPKQHRGGSY)2K)2KK

[18F]Fluorobenzoyl anti-HER2 Cys-diabody

[18F]Fluorobenzoyl-PEGylated cyclic arginine-glycine-aspartic acid peptide

[18F]Fluorobenzyl-bombesin[7-14]-c(RGDyK)

[18F]Fluorobenzyl-PEG3-Glu-c(RGDyK)-bombesin[7-14]

[18F]Fluorocholine

[18F]Fluorodipalmitin-labeled liposomes

[18F]Fluoroerythronitroimidazole

[18F]Fluoroetanidazole

[18F]Fluoroethylcholine

[18F]Fluoroethyl-recombinant human interlukin-1 receptor antagonist

[18F]Fluoromethyl-d-tyrosine

[18F]Fluoromisonidazole

[18F]Fluoropropyl-Tanaproget

[18F]-Labeled (R)-(2-(2-(2-methylpyrrolidin-1-yl)ethyl)benzofuran-5-yl)(4-fluorophenyl)-methanone

[18F]N-(2-benzofuranylmethyl)-N'-[4-(2-fluoroethoxy)benzyl]piperazine

[18F]-N-(2-Chloro-6-methylphenyl)-2-(6-(4-(2-fluoroethyl)piperazin-1-yl)-2-methylpyrimidin-4-ylamino)thiazole-5-carboxamide

[18F]-N-{4-[(4,5-Dichloro-2-fluorophenyl)amino]quinazoline-6-yl}-dimethylamine-butylamide

[18F]Norchloro-fluoro-homoepibatidine

[18F]SB209670

[18F]Y1-973

[18F]α/γ-Fluorobenzylamine-folate

[2-[18F]Fluoromethoxy-5-(5-trifluoromethyl-tetrazol-1-yl)-benzyl]([2S,3S]2-phenyl-piperidin-3-yl)-amine

1-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)-4-((6-[18F]fluoropyridin-3-yl)methyl)piperazine

1-(2'-Deoxy-2'-[18F]fluoroarabinofuranosyl)cytosine

1-(2'-Deoxy-2'-[18F]fluoro-β-d-arabinofuranosyl)-5-iodocytosine

1-(2-[18F]Fluoro-3-pyridyl)-4-(2-isopropyl-1-oxo-isoindoline-5-yl)-5-methyl-1H-1,2,3-triazole

1-(2-[18F]Fluoro-3-pyridyl)-4-(2-propyl-1-oxo-isoindoline-5-yl)-5-methyl-1H-1,2,3-triazole

1-(2-{(2R)-1-[(2-[18F]Fluorophenyl)sulfonyl]pyrrolidin-2-yl}ethyl)-4-methylpiperidine

1-(2’-Deoxy-2’-[18F]-fluoro-β-D-arabinofuranosyl)thymine

1-(4-[18F]Fluoroethoxy-3-methoxyphenethyl)-4-(3-phenylpropyl)piperazine

1-(4-[18F]Fluoromethoxy-3-methoxyphenethyl)-4-(3-phenylpropyl)piperazine

1-(5-[18F]Fluoro-5-deoxy-α-D-arabinofuranosyl)-2-nitroimidazole

1-[18F]Fluoro-3,6-dioxatetracosane

1-[4-(2-[18F]Fluoroethoxy)-benzyl]-5-(2-phenoxymethyl-pyrrolidine-1-sulfonyl)-1H-indole-2,3-dione

1-[4-(3-[18F]Fluoropropoxy)-3-methoxyphenyl]-5-hydroxy-7-(4-hydroxy-3-methoxyphenyl)-1,4,6-heptatrien-3-one

11C-BMS-5p and 18F-FBzBMS: radiolabeled analogs of BMS-207940, a potent and selective antagonist of endothelin receptor subtype A

16α-[18F]Fluoro-17β-estradiol

18-[18F]Fluoro-4-thia-oleate

18-[18F]Fluoro-4-thia-palmitate

18F-(2S,4R)4-fluoroglutamine

18F-1,4,7-Triazacyclononane-1,4,7-triacetic acid-10-maleimidoethylacetamide-Affibody ZHER2:2395

18F-6-Fluoro-N-[2-(diethylamino)ethyl]pyridine-3-carboxamide

18F-Fluoroethyl triazole-βAG-[(d)-Phe1-c(Cys2-Tyr3-(d)-Trp4-Lys5-Thr6-Cys7)Thr8]

18F-Labeled 4-(5-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N,N-dimethylbenzenamine

18F-Labeled 5-(5-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N,N-dimethylpyridin-2-amine

18F-Labeled 6-amino-2-(4’-fluorophenyl)-1,3-benzothiazole and other derivatives

18F-Labeled 6-methyl-2-(4’-fluorophenyl)-1,3-benzothiazole

18F-Labeled Cys-ZHER2:342, an anti-epidermal growth factor receptor-2 Affibody

18F-Labeled exendin(9-39)

18F-Labeled fluoropegylated 6-fluoroethoxy-4'-dimethylaminoflavone, 6-(2-(2-fluoro-ethoxy)-ethoxy)-4'-dimethylaminoflavone, and 6-(2-(2-(2-fluoro-ethoxy)-ethoxy)ethoxy)-4'-dimethylaminoflavone

18F-Labeled N-(4-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)butyl)-2-(2-[18F]-fluoroethoxy)-5-iodo-3-methoxybenzamide

18F-Labeled N-(4-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)butyl)-2-(2-fluoroethoxy)-5-methylbenzamide

18F-Labeled N-(4-fluorobenzylidene)oxime-dimeric (ZHER2:477)2

18F-Labeled N-(4-fluorobenzylidene)oxime-monomeric ZHER2:477

18F-Labeled N-(4-fluorobenzylidene)oxime-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC

18F-Labeled neogalactosylalbumin

18F-Labeled N-succinimidyl-4-fluorobenzoate–conjugated rat anti-mouse vascular endothelial growth factor receptor 2 monoclonal antibody linked to microbubbles

18F-Labeled poly(L-lactic acid)-block-poly(sarcosine) lactosome, a polymer micelle

18F-Tetrazine-trans-cyclooctene-Cys40-exendin-4

1-Deoxy-1-[18F]fluoro-scyllo-inositol

1-O-(4-(2-[18F]Fluoroethyl-carbamoyloxymethyl)-2-nitrophenyl)-O-β-d-glucopyronuronate

2´-Deoxy-2´-[18F]fluoro-5-fluoro-1-β-D-arabinofuranosyluracil

2'-Deoxy-2'-[18F]fluoro-1-β-D-arabinofuranosyl-adenine

2-((2-Amino-4-chloro-5-[18F]fluorophenyl)thio)-N,N-dimethylbenzenmethanamine

2-(+/-)-2-exo-(2'-[18F]Fluoro-3'-phenyl-pyridin-5'-yl)-7-azabicyclo[2.2.1]heptane

2-(1-{6-[(2-[18F]Fluoroethyl)(methyl)amino]-2-naphthyl}ethylidene)malononitrile

2-(2'-((Dimethylamino)methyl)-4'-(3-[18F]fluoropropoxy)-phenylthio)benzenamine

2-(2-(2-(4-((4-(Methylamino)phenyl)ethynyl)phenoxy)ethoxy)[18F]fluoroethoxy)ethyl-4-methylbenzenamine

2-(2-Nitro-1H-imidazol-1-yl)ethyl 2-[18F]fluoroacetate

2-(2-Nitro-1H-imidazol-1-yl)-N-(2,2,3,3,3-[18F]pentafluoropropyl)-acetamide

2-(2-Nitroimidazol-1H-yl)-(3-[18F]fluoropropyl)acetamide

2-(3-{1-Carboxy-5-[(6-[18F]fluoro-pyridine-3-carbonyl)-amino]-pentyl}-ureido)-pentanedioic acid

2-(4-(2-[18F]Fluoroethyl)piperidin-1-yl)benzo[4,5]imidazo[1,2-a]pyrimidine

2-(4-(4-[18F]Fluoro-butyl)-benzylsulfanyl)-3-methyl-chromen-4-one

2-(4-Aminophenyl)-6-(2-([18F]fluoroethoxy))quinoline

2-(5-[18F]Fluoro-pentyl)-2-methyl-malonic acid (ML-10)

2-(6-Chloro-2-(4-(3-[18F]fluoropropoxy)phenyl)imidazo[1,2-a]pyridin-3-yl)-N,N-diethylacetamide

2-[(2-chloro-2’-18F-fluorodiethyl)amino]-2H-1,3,2-oxazaphosphorinane-2-oxide

2-[(4-{[(2-amino-4-oxohydropteridin-7yl)methyl]amino}phenyl) carbonylamino]-4-{N-[(2-[18F]-fluoro(4-pyridyl))carbonylamino] carbamoyl}butanoic acid

2-[(4-{[(2-amino-4-oxohydropteridin-7yl)methyl]amino}phenyl) carbonylamino]-4-{N-[(4-[18F]-fluorophenyl)carbonylamino] carbamoyl}butanoic acid

2-[18F]Fluoro-3-[2-((S)-3-pyrrolinyl)methoxy]pyridine

2-[18F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine

2-[18F]Fluoroacetate

2-[18F]Fluoro-N-(2-(2-nitro-1H-imidazol-1-yl)ethyl)acetamide

2-[18F]Fluoropropionyl-osteosarcoma–specific peptide-1 (ASGALSPSRLDT)

2-[18F]Fluoropyridine-4-carbohydrazide-methotrexate

2-[4-(4-[18F]Fluorobutyl)benzylsulfanyl]-3-methylchromene-4-one

2-{3-[18F]Fluoro-4-(methylamino)phenyl}-1,3-benzothiazol-6-ol

2-{4-[-Pyridin-4-yl-1-(2-[18F]fluoro-ethyl)-1H-pyrazol-3-yl]-phenoxymethyl}-quinoline

2-Deoxy-2-[18F]fluorosorbitol

2-tert-Butyl-4-chloro-5-[4-(2-[18F]fluoroethoxymethyl)-benzyloxy]-2H-pyridazin-3-one

2-tert-Butyl-4-chloro-5-[4-(2-[18F]fluoro-ethoxymethyl)-benzyloxy]-3-(2H)-pyridazinone

2-tert-Butyl-4-chloro-5-[4-(4-[18F]fluoro-butyl)-benzyloxy]-2H-pyridazin-3-one

2β-Carbo(2-[18F]fluoroethoxy)-3β-(3´-((Z)-2-iodoethenyl)phenyl)nortropane

2β-Carbo(2-[18F]fluoroethoxy)-3β-(4´-((Z)-2-iodoethenyl)phenyl)nortropane

2β-Carbomethoxy-3β-(4-chlorophenyl)-8-(2-[18F]fluoroethyl)nortropane

2’-[18F]Fluoroflumazenil

2’-[18F]Fluorofolic acid

3'-Aza-2'-[18F]fluorofolic acid

3'-Deoxy-3'-[18F]fluoro-1-β-D-xylofuranosyl-adenine

3'-Deoxy-3'-[18F]fluorothymidine

3-(2-(S)-3,4-Dehydropyrrolinyl methoxy)-5-(3'-[18F]fluoropropyl)pyridine

3-(3-(3-[18F]Flouropropyl)thio)-1,2,5-thiadiazol-4-yl)-1,2,5,6-tetrahydro-1-methylpyridine

3-(4-[18F]Fluorobenzyl)-8-methoxy-1,2,3,4 tetrahydrochromeno[3,4-c]pyridin-5-one

3-(Pyridin-2-ylethynyl)-cyclohex-2-enone-O-[18F]fluoroethyl-oxime

3-[2-[4-(4-[18F]Fluorobenzoyl)-1-piperidyl]ethyl]-2-sulfanyl-3H-quinazolin-4-one

3-{4-[2-[Benzoxazol-2-yl-methylamino]ethoxy]phenyl}-2-(2-[18F]fluoroethoxy)propionic acid

3-Chloro-4-[18F]fluorophenyl-(4-fluoro-4-[[((5-methyl-4-methylamino-pyridin-2-ylmethyl)-amino]-methyl]-piperidin-1-yl)methanone (F13714)

3-Chloro-4-[18F]fluorophenyl-(4-fluoro-4-[[(5-methyl-pyrimidin-2-ylmethyl)-amino]-methyl]-piperidin-1-yl)methanone (F15599)

3-Cyano-4-[18F]fluoro-benzoyl-Ala(SO3H)-Ala(SO3H)-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH2

3-Cyano-4-[18F]fluoro-benzoyl-Ala(SO3H)-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH2

3-Cyano-4-[18F]fluoro-benzoyl-Arg-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH2

3-N-(2-[18F]Fluoroethyl)spiperone

3-β-(4-Iodophenyl)tropane-2-β-carboxylic acid 2-[18F]fluoroethyl ester

4,16α-[16α-18F]Difluoro-11β-methoxyestradiol

4-(2´-Methoxyphenyl)-1-[2´-(N-2´´-1,3 pyrimidino)-p-[18F]fluorobenzamido]ethylpiperazine

4-(2´-Methoxyphenyl)-1-[2´-(N-2´´-pyridinyl)-p-[18F]fluorobenzamido]ethylpiperazine

4-(2-(4-(4-[18F]Fluoro-butyl)-phenyl)ethoxy) quinazoline

4-(3-((5-(2-[18F]Fluoroethoxy)pyridine-2-yl)oxy)benzylidene)-N-(pyridazin-3-yl)piperidine-1-carboxamide

4-[18F]Fluoro-2-D-methyl-3-mercaptopropanoyl-L-proline

4-[18F]Fluorobenzenecarbohydrazide-methotrexate

4-[18F]Fluorobenzoyl-annexin V

4-[18F]Fluorobenzoyl-Arg-Arg-Natl-Cys-Tyr-Cit-Lys-d-Lys-Pro-Tyr-Arg-Cit-Cys-Arg-NH2

4-[18F]Fluorobenzoyl-C2A domain of synaptotagmin I-glutathione-S-transferase

4-[18F]Fluorobenzoyl-endothelin-1

4-[18F]Fluorobenzoyl-knottin 2.5D

4-[18F]Fluorobenzoyl-NAVPNLRGDLQVLAQKVART

4-[18F]Fluorobenzoyl-Phe-Ala-Leu-Gly-Glu-Ala-NH2

4-[18F]Fluorobenzoyl-rhenium-cyclized-Ac-D-Lys-[Cys3,4,10, D-Phe7, Arg11]α-MSH3-13

4-[18F]Fluorobenzoyl-T84.66 diabody

4-[18F]Fluorobenzoyl-ε-Lys1-c(KRGDe)MDDPGRNPHhCitGPAT

4-[18F]Fluorobenzyl-triphenylphosphonium

4-[18F]Fluoro-l-m-tyrosine

4-[18F]Fluoro-N-[4-[6-(isopropylamino)pyrimidin-4-yl]-1,3-thiazol-2-yl]-N-methylbenzamide

4-[18F]Fluoropaclitaxel

4-[5-(4-[18F]Fluoro-phenyl)-[1,3,4]oxadiazol-2-yl]-1,4-diaza-bicyclo[3.2.2]nonane

4-Bromo-1-(3-[18F]fluoropropyl)-2-nitroimidazole

5-(2-[18F]Fluoroethoxy)-L-tryphan

5-(5-(2-(2-(2-[18F]Fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N-methylbenzenamine

5-(5-(2-(2-(2-[18F]Fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N-methylpyridin-2-amine

5-[(E)-2-(4-[18F]Fluorophenyl)ethenyl]-1,3-benzenediol

5-[18F]Fluoro-2-(1-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl)-oxazolo[5,4-b]pyridine

5-3’-[18F]Fluoropropyl-3-[2-((S)-pyrrolidinyl)methoxy]pyridine

6-(2-[18F]Fluoroethoxy)-2-[2-(4-methylaminophenyl)ethenyl]benzoxazole

6-(3'-[18F]Fluoropropyl)-2-(4'-dimethylamino)phenylimidazol[1,2-α]pyridine

6-[1-(2-[18F]Fluoro-3-pyridyl)-5-methyl-1H-1,2,3-triazol-4-yl]quinoline

6-[18F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine

6-[18F]Fluorodopamine

6-[18F]Fluoro-l-m-tyrosine

6-Deoxy-6-[18F]fluoro-D-fructose

6-Iodo-2-[4'-N-(2-[18F]fluoroethyl)methylamino]phenylimidazo[1,2-a]pyridine

6-O-(2-[18F]Fluoroethyl)-6-O-desmethyldiprenorphine

8-Cyclopentyl-3-(3-[18F]fluoropropyl)-1-propylxanthine

9-(4-(2-[18F]Fluoroethyl)benzyl)-9-azabicyclo[3.3.1]nonan-3-yl-2-methoxy-5-methyl-phenylcarbamate

9-(4-[18F]Fluoro-3-hydroxymethylbutyl)guanine

Ad5-(PSE-BC)-(GAL4-(VP16)2)-(GAL4)5-sr39tk

Al18F-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]2

Al18F-1,4,7-Triazacyclononane-1,4,7-diacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2

anti-1-Amino-2-[18F]fluorocyclobutane-1-carboxylic acid

anti-1-Amino-3-[18F]fluorocyclobutane-1-carboxylic acid

CtPyPyIm-(R)H2Nγ-PyImPyPy-C3-18F

Cyclo(-Arg-Gly-Asp-d-Phe-Lys(([18F]Fluoropropionyl)galacto-amino acid)-)

Cys-Arg-Pro-Pro-Arg-[18F]fluorodipalmitin-liposomes

Fluoro-pegylated (1E,4E)-1-(4-(dimethylamino)phenyl)-5-(4-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)phenyl)penta-1,4-dien-3-one and (1E,4E)-1-(4-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)phenyl)-5-(4-(methylamino)phenyl)penta-1,4-dien-3-one

ImPyβImPyβImβ-C3-18F

L-3,4-Dihydroxy-6-[18F]fluorophenylalanine

L- and D-S-(3-[18F]fluoropropyl)homocysteine

m-Cyano-p-[18F]fluorohippurate

Methyl 2-(2-[18F]fluoro-4-nitrobenzamido)-3-methylbutanoate

Methyl 2-(2-[18F]fluoro-4-nitrobenzamido)-3- methylbutanoic acid

Methyl ester of 1-O-(4-(2-[18F]fluoroethyl-carbamoyloxymethyl)-2-nitrophenyl)-O-β-d-glucopyronuronate

N-((E)-4-[18F]Fluorobut-2-en-1-yl)-2β-carbomethoxy-3β-(4'-fluorophenyl)nortropane

N-(2-(1-(4-(2-Methoxyphenyl)piperazinyl)ethyl))-N-(2-(6-[18F]fluoro)-pyridinyl)cyclohexanecarboxamide

N-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)-4-[18F]-fluorobenzamide ([18F]FBEM) conjugated to EM3106B, an analog of glucagon-like peptide-1

N-(2-(Diethylamino)ethyl)-6-[18F]fluoronicotinamide

N-(2-Diethylaminoethyl)-4-[18F]fluorobenzamide for imaging melanoma

N-(3-[18F]Fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane

N-(4-(4-(2-(2-[18F]Fluoroethoxy)phenyl)piperazine-1-yl)butyl)-4-(3-thienyl)benzamide

N-(4-[18F]Fluoro-benzoyl)-N'-{2-[5-(4-fluoro-benzyl)-1-(4-methoxy-benzyl)-4,6-dioxo-1,4,5,6-tetrahydro-[1,3,5]triazin-2-ylamino]-ethyl}-guanidine

N-(4-[18F]Fluorobenzyl)-4-(3-(piperidin-1-yl)indole-1-sulfonyl)benzamide

N-(5-Fluoro-2-phenoxyphenyl)-N-(2-[18F]fluoroethyl-5-methoxybenzyl)acetamide

N-(6-[18F]Fluoro-4-phenoxypyridin-3-yl)-N-(2-methoxybenzyl)acetamide

N-[18F]Fluoroacetyl-N-(2,5-dimethoxybenzyl)-2-phenoxyaniline

N-[18F]Fluoroethylpiperidin-4ylmethyl acetate

N-[2-(3-cyanophenyl)-3-(4-(2-[18F]fluorethoxy)phenyl)-1-methylpropyl]-2-(5-methyl-2-pyridyloxy)-2-methylproponamide

N-[2-(4-[18F]Fluorobenzamido)ethyl]maleimide-Cys-ZEGFR:1907

N-[2-(4-[18F]Fluorobenzamido)ethyl]maleimide-sulfhydryl-cyclic-arginine-glycine-aspartic acid dimeric peptide

N-[2-(4-[18F]Fluorobenzamido)ethyl]maleimide-sulfhydryl-cyclic-arginine-glycine-aspartic acid peptide

N-[2-[N-Ethyl-N-[2-(2-[18F]fluoropyridin-3-yloxy)ethyl]amino]ethyl]-6-iodoquinoxaline-2-carboxamide

N-[N-[(S)-1,3-Dicarboxypropyl]carbamoyl]-4-[18F]fluorobenzyl-L-cysteine

N-{2-[4-(2-Methoxyphenyl)piperazinyl]ethyl}-N-(2-pyridyl)-N-(4-[18F]-fluoromethylcyclohexane)carboxamide

N-2-(4-[18F]-Fluorobenzamido)ethylmaleimide coupled to cysteine-tagged epidermal growth factor

N-2-(4-[18F]-Fluorobenzamido)ethylmaleimide coupled to cysteine-tagged on the C- or N-terminal of exendin-4

N-4'-[18F]Fluorobenzylpiperidin-4yl-(2-fluorophenyl)acetamide

N-4-[18F]Fluorobenzoyl-c(RGDyK)

N-4-[18F]Fluorobenzoyl-c[(RGDyK)]2

N-4-[18F]Fluorobut-2-yn-1-yl-2β-carbomethoxy-3β-phenyltropane

N-Acetyl-N-(2-[18F]fluoroethoxybenzyl)-2-phenoxy-5-pyridinamine

N-Benzyl-N-ethyl-2-[7,8-dihydro-7-(2-[18F]fluoroethyl)-8-oxo-2-phenyl-9H-purin-9-yl]acetamide

N-Benzyl-N-methyl-2-[7,8-dihydro-7-(2-[18F]fluoroethyl)-8-oxo-2-phenyl-9H-purin-9-yl]acetamide

O-(2-[18F]Fluoroethyl)-L-tyrosine

O-(3-[18F]Fluoropropyl)-L-tyrosine

p-(2-[18F]Fluoroethyl)-l-phenylalanine

P2,P3-[18F]Monofluoromethylene diadenosine-5’,5’’’-P1,P4-tetraphosphate

Para-[18F]-fluorohippurate

PEGylated 4-[18F]fluorobenzoyl-NAVPNLRGDLQVLAQKVART

Polyethylene glycol-Cys-Arg-Ser-Gly-Pro-Leu-Gly-Val-Tyr-[18F]fluorobenzoyl-Lys-Lys-tetramethylrhodamine

syn-1-Amino-3-[18F]fluorocyclobutane-1-carboxylic acid

Trans-1,2,3,5,6,10b-hexahydro-6-[4-([18F]fluoroethylthio)-phenyl]pyrrolo-[2,1-a]-isoquinoline

Trans-4-(N-Methylamino)-4´-{2-[2-(2-[18F]fluoro-ethoxy)-ethoxy]-ethoxy}-stilbene

PubReader format: click here to try

Views

Search MICAD

Limit my Search:


Recent Activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...