NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|530427263|ref|XP_005272294|]
View 

PREDICTED: ADAMTS-like protein 2 isoform X1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ADAM_spacer1 super family cl20316
ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of ...
325-439 1.64e-28

ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of metalloproteinases.


The actual alignment was detected with superfamily member pfam05986:

Pssm-ID: 253493  Cd Length: 114  Bit Score: 111.93  E-value: 1.64e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530427263   325 VTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYET 404
Cdd:pfam05986    3 VKGTFTKALLSHGYNDVVTIPAGATHILIRELKASGNYLALKNSDGEYYLNGNWTISWSGTFELAGTVFEYSRSDDAPER 82
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 530427263   405 gieyIVAQGPTNQGLNVMVWNQNGKSPSITFEYTL 439
Cdd:pfam05986   83 ----LTATGPTNEPLTVQVLSQGATNPGIRYEYFI 113
PLAC pfam08686
PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short ...
1024-1056 1.54e-10

PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short six-cysteine region that is usually found at the C terminal of proteins. It is found in a range of proteins including PACE4 (paired basic amino acid cleaving enzyme 4) and the extracellular matrix protein lacunin.


:

Pssm-ID: 254972  Cd Length: 34  Bit Score: 58.03  E-value: 1.54e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 530427263  1024 SCQDQPGTNCALAIKVNLCGHWYYSKACCRSCR 1056
Cdd:pfam08686    1 ECKDSPRTNCELVVQARLCSHKYYRQRCCRSCR 33
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
159-215 2.08e-09

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 55.29  E-value: 2.08e-09
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*..
gi 530427263    159 WGEWTKWTACSRSCGGGVTSQERHCLQQRrksvPGPGNRTCTGTSKRYQLCRVQECP 215
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPP----PQNGGGPCTGEDVETRACNEQPCP 53
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
968-1017 9.65e-05

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 41.42  E-value: 9.65e-05
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|
gi 530427263    968 TSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCP 1017
Cdd:smart00209    4 WSEWSPCSVTCGGGVQTRTRSCCSPPPQNGGGPCTGEDVETRACNEQPCP 53
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
735-758 2.44e-04

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 40.26  E-value: 2.44e-04
                            10        20
                    ....*....|....*....|....
gi 530427263    735 WETSSWSECSRTCGEGYQFRVVRC 758
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSC 25
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
850-898 3.03e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


:

Pssm-ID: 214559  Cd Length: 53  Bit Score: 37.18  E-value: 3.03e-03
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|..
gi 530427263    850 WTVSDWGPCSGSCGQGRTIRHVYCKTSDGRvVPESQCQ---METKPLAIHPC 898
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSCCSPPPQ-NGGGPCTgedVETRACNEQPC 52
 
Name Accession Description Interval E-value
ADAM_spacer1 pfam05986
ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of ...
325-439 1.64e-28

ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of metalloproteinases.


Pssm-ID: 253493  Cd Length: 114  Bit Score: 111.93  E-value: 1.64e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530427263   325 VTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYET 404
Cdd:pfam05986    3 VKGTFTKALLSHGYNDVVTIPAGATHILIRELKASGNYLALKNSDGEYYLNGNWTISWSGTFELAGTVFEYSRSDDAPER 82
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 530427263   405 gieyIVAQGPTNQGLNVMVWNQNGKSPSITFEYTL 439
Cdd:pfam05986   83 ----LTATGPTNEPLTVQVLSQGATNPGIRYEYFI 113
PLAC pfam08686
PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short ...
1024-1056 1.54e-10

PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short six-cysteine region that is usually found at the C terminal of proteins. It is found in a range of proteins including PACE4 (paired basic amino acid cleaving enzyme 4) and the extracellular matrix protein lacunin.


Pssm-ID: 254972  Cd Length: 34  Bit Score: 58.03  E-value: 1.54e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 530427263  1024 SCQDQPGTNCALAIKVNLCGHWYYSKACCRSCR 1056
Cdd:pfam08686    1 ECKDSPRTNCELVVQARLCSHKYYRQRCCRSCR 33
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
159-215 2.08e-09

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 55.29  E-value: 2.08e-09
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*..
gi 530427263    159 WGEWTKWTACSRSCGGGVTSQERHCLQQRrksvPGPGNRTCTGTSKRYQLCRVQECP 215
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPP----PQNGGGPCTGEDVETRACNEQPCP 53
TSP_1 pfam00090
Thrombospondin type 1 domain;
160-214 4.90e-05

Thrombospondin type 1 domain;


Pssm-ID: 249579  Cd Length: 48  Bit Score: 42.39  E-value: 4.90e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 530427263   160 GEWTKWTACSRSCGGGVTSQERHCLQQrrksvpgPGNRTCTGTSKRYQLCRVQEC 214
Cdd:pfam00090    1 SPWSEWSPCSVTCGKGIRTRQRTCNSP-------FGGPPCTGDVQETEACMMDKC 48
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
968-1017 9.65e-05

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 41.42  E-value: 9.65e-05
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|
gi 530427263    968 TSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCP 1017
Cdd:smart00209    4 WSEWSPCSVTCGGGVQTRTRSCCSPPPQNGGGPCTGEDVETRACNEQPCP 53
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
735-758 2.44e-04

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 40.26  E-value: 2.44e-04
                            10        20
                    ....*....|....*....|....
gi 530427263    735 WETSSWSECSRTCGEGYQFRVVRC 758
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSC 25
TSP_1 pfam00090
Thrombospondin type 1 domain;
968-1016 1.39e-03

Thrombospondin type 1 domain;


Pssm-ID: 249579  Cd Length: 48  Bit Score: 38.15  E-value: 1.39e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 530427263   968 TSPWSECTKTCGVGVRMRDVKCyqgtDIVRGCDPLVKPVGR-QACDLQPC 1016
Cdd:pfam00090    3 WSEWSPCSVTCGKGIRTRQRTC----NSPFGGPPCTGDVQEtEACMMDKC 48
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
850-898 3.03e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 37.18  E-value: 3.03e-03
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|..
gi 530427263    850 WTVSDWGPCSGSCGQGRTIRHVYCKTSDGRvVPESQCQ---METKPLAIHPC 898
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSCCSPPPQ-NGGGPCTgedVETRACNEQPC 52
 
Name Accession Description Interval E-value
ADAM_spacer1 pfam05986
ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of ...
325-439 1.64e-28

ADAM-TS Spacer 1; This family represents the Spacer-1 region from the ADAM-TS family of metalloproteinases.


Pssm-ID: 253493  Cd Length: 114  Bit Score: 111.93  E-value: 1.64e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530427263   325 VTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYET 404
Cdd:pfam05986    3 VKGTFTKALLSHGYNDVVTIPAGATHILIRELKASGNYLALKNSDGEYYLNGNWTISWSGTFELAGTVFEYSRSDDAPER 82
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 530427263   405 gieyIVAQGPTNQGLNVMVWNQNGKSPSITFEYTL 439
Cdd:pfam05986   83 ----LTATGPTNEPLTVQVLSQGATNPGIRYEYFI 113
PLAC pfam08686
PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short ...
1024-1056 1.54e-10

PLAC (protease and lacunin) domain; The PLAC (protease and lacunin) domain is a short six-cysteine region that is usually found at the C terminal of proteins. It is found in a range of proteins including PACE4 (paired basic amino acid cleaving enzyme 4) and the extracellular matrix protein lacunin.


Pssm-ID: 254972  Cd Length: 34  Bit Score: 58.03  E-value: 1.54e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 530427263  1024 SCQDQPGTNCALAIKVNLCGHWYYSKACCRSCR 1056
Cdd:pfam08686    1 ECKDSPRTNCELVVQARLCSHKYYRQRCCRSCR 33
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
159-215 2.08e-09

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 55.29  E-value: 2.08e-09
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|....*..
gi 530427263    159 WGEWTKWTACSRSCGGGVTSQERHCLQQRrksvPGPGNRTCTGTSKRYQLCRVQECP 215
Cdd:smart00209    1 WSEWSEWSPCSVTCGGGVQTRTRSCCSPP----PQNGGGPCTGEDVETRACNEQPCP 53
TSP_1 pfam00090
Thrombospondin type 1 domain;
160-214 4.90e-05

Thrombospondin type 1 domain;


Pssm-ID: 249579  Cd Length: 48  Bit Score: 42.39  E-value: 4.90e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 530427263   160 GEWTKWTACSRSCGGGVTSQERHCLQQrrksvpgPGNRTCTGTSKRYQLCRVQEC 214
Cdd:pfam00090    1 SPWSEWSPCSVTCGKGIRTRQRTCNSP-------FGGPPCTGDVQETEACMMDKC 48
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
968-1017 9.65e-05

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 41.42  E-value: 9.65e-05
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|
gi 530427263    968 TSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCP 1017
Cdd:smart00209    4 WSEWSPCSVTCGGGVQTRTRSCCSPPPQNGGGPCTGEDVETRACNEQPCP 53
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
735-758 2.44e-04

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 40.26  E-value: 2.44e-04
                            10        20
                    ....*....|....*....|....
gi 530427263    735 WETSSWSECSRTCGEGYQFRVVRC 758
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSC 25
TSP_1 pfam00090
Thrombospondin type 1 domain;
968-1016 1.39e-03

Thrombospondin type 1 domain;


Pssm-ID: 249579  Cd Length: 48  Bit Score: 38.15  E-value: 1.39e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 530427263   968 TSPWSECTKTCGVGVRMRDVKCyqgtDIVRGCDPLVKPVGR-QACDLQPC 1016
Cdd:pfam00090    3 WSEWSPCSVTCGKGIRTRQRTC----NSPFGGPPCTGDVQEtEACMMDKC 48
TSP1 smart00209
Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
850-898 3.03e-03

Thrombospondin type 1 repeats; Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.


Pssm-ID: 214559  Cd Length: 53  Bit Score: 37.18  E-value: 3.03e-03
                            10        20        30        40        50
                    ....*....|....*....|....*....|....*....|....*....|..
gi 530427263    850 WTVSDWGPCSGSCGQGRTIRHVYCKTSDGRvVPESQCQ---METKPLAIHPC 898
Cdd:smart00209    2 SEWSEWSPCSVTCGGGVQTRTRSCCSPPPQ-NGGGPCTgedVETRACNEQPC 52
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH