NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|37622894|ref|NP_919442.1|]
View 

E3 ubiquitin-protein ligase RNF126

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RING cd00162
RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 ...
228-273 4.58e-11

RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)


:

Pssm-ID: 238093  Cd Length: 45  Bit Score: 57.07  E-value: 4.58e-11
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 37622894 228 ECPVCKDDYalGERVRQLPCNHLFHDGCIVPWLEQ-HDSCPVCRKSL 273
Cdd:cd00162   1 ECPICLEEF--REPVVLLPCGHVFCRSCIDKWLKSgKNTCPLCRTPI 45
zf-RING_3 pfam14369
zinc-finger;
10-40 5.26e-10

zinc-finger;


:

Pssm-ID: 258540  Cd Length: 34  Bit Score: 54.10  E-value: 5.26e-10
                          10        20        30
                  ....*....|....*....|....*....|...
gi 37622894    10 RYFCHCCS--VEIVPRLPDYICPRCESGFIEEL 40
Cdd:pfam14369   2 RYWCYQCDrfVRIAPSGDSDVCPRCGGGFVEEI 34
 
Name Accession Description Interval E-value
RING cd00162
RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 ...
228-273 4.58e-11

RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)


Pssm-ID: 238093  Cd Length: 45  Bit Score: 57.07  E-value: 4.58e-11
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 37622894 228 ECPVCKDDYalGERVRQLPCNHLFHDGCIVPWLEQ-HDSCPVCRKSL 273
Cdd:cd00162   1 ECPICLEEF--REPVVLLPCGHVFCRSCIDKWLKSgKNTCPLCRTPI 45
zf-RING_2 pfam13639
Ring finger domain;
228-270 3.30e-15

Ring finger domain;


Pssm-ID: 257949  Cd Length: 44  Bit Score: 68.18  E-value: 3.30e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 37622894   228 ECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCR 270
Cdd:pfam13639   2 ECPICLDEFEEGEEVVVLPCGHVFHKECLDKWLRSSPTCPLCR 44
zf-RING_3 pfam14369
zinc-finger;
10-40 5.26e-10

zinc-finger;


Pssm-ID: 258540  Cd Length: 34  Bit Score: 54.10  E-value: 5.26e-10
                          10        20        30
                  ....*....|....*....|....*....|...
gi 37622894    10 RYFCHCCS--VEIVPRLPDYICPRCESGFIEEL 40
Cdd:pfam14369   2 RYWCYQCDrfVRIAPSGDSDVCPRCGGGFVEEI 34
RING smart00184
Ring finger; E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and ...
229-269 1.19e-08

Ring finger; E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)


Pssm-ID: 214546  Cd Length: 40  Bit Score: 50.20  E-value: 1.19e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 37622894    229 CPVCKDDYAlgERVRQLPCNHLFHDGCIVPWLEQHD-SCPVC 269
Cdd:smart00184   1 CPICLEEYL--KDPVILPCGHTFCRSCIRKWLESGNnTCPIC 40
APC11 COG5194
Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational ...
229-271 6.39e-05

Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning];


Pssm-ID: 227521  Cd Length: 88  Bit Score: 40.20  E-value: 6.39e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 37622894 229 CPVCKDDYALGER--VRQLPCNHLFHDGCIVPWLEQHDSCPVCRK 271
Cdd:COG5194  34 CPECQFGMTPGDEcpVVWGVCNHAFHDHCIYRWLDTKGVCPLDRQ 78
HybF COG0375
Hydrogenase maturation metallochaperone HypA/HybF, involved in Ni insertion [Posttranslational ...
8-36 9.09e-03

Hydrogenase maturation metallochaperone HypA/HybF, involved in Ni insertion [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223452  Cd Length: 115  Bit Score: 34.18  E-value: 9.09e-03
                        10        20
                ....*....|....*....|....*....
gi 37622894   8 PGRYFCHCCSVEIVPRLPDYICPRCESGF 36
Cdd:COG0375  68 PAECWCLDCGQEVELEELDYRCPKCGSIN 96
COG5540 COG5540
RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, ...
219-273 7.69e-11

RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227827 [Multi-domain]  Cd Length: 374  Bit Score: 61.16  E-value: 7.69e-11
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 37622894 219 TEEHvGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQH-DSCPVCRKSL 273
Cdd:COG5540 317 AVEA-DKGVECAICMSNFIKNDRLRVLPCDHRFHVGCVDKWLLGYsNKCPVCRTAI 371
zf-rbx1 pfam12678
RING-H2 zinc finger; There are 8 cysteine/ histidine residues which are proposed to be the ...
228-270 2.28e-07

RING-H2 zinc finger; There are 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding. The protein, of which this domain is the conserved region, participates in diverse functions relevant to chromosome metabolizm and cell cycle control.


Pssm-ID: 257215 [Multi-domain]  Cd Length: 73  Bit Score: 47.05  E-value: 2.28e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 37622894   228 ECPVckddyALGErvrqlpCNHLFHDGCIVPWLEQHDSCPVCR 270
Cdd:pfam12678  42 DCPV-----VWGE------CGHAFHLHCISRWLKTRNTCPLCR 73
PHA02929 PHA02929
N1R/p28-like protein; Provisional
247-271 2.48e-04

N1R/p28-like protein; Provisional


Pssm-ID: 222944 [Multi-domain]  Cd Length: 238  Bit Score: 40.53  E-value: 2.48e-04
                         10        20
                 ....*....|....*....|....*
gi 37622894  247 CNHLFHDGCIVPWLEQHDSCPVCRK 271
Cdd:PHA02929 200 CNHVFCIECIDIWKKEKNTCPVCRT 224
rad18 TIGR00599
DNA repair protein rad18; All proteins in this family for which functions are known are ...
225-272 1.35e-03

DNA repair protein rad18; All proteins in this family for which functions are known are involved in nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273165 [Multi-domain]  Cd Length: 397  Bit Score: 38.45  E-value: 1.35e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 37622894   225 SGLECPVCKDDYalgeRVRQL-PCNHLFHDGCIVPWLEQHDSCPVCRKS 272
Cdd:TIGR00599  25 TSLRCHICKDFF----DVPVLtSCSHTFCSLCIRRCLSNQPKCPLCRAE 69
 
Name Accession Description Interval E-value
RING cd00162
RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 ...
228-273 4.58e-11

RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)


Pssm-ID: 238093  Cd Length: 45  Bit Score: 57.07  E-value: 4.58e-11
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 37622894 228 ECPVCKDDYalGERVRQLPCNHLFHDGCIVPWLEQ-HDSCPVCRKSL 273
Cdd:cd00162   1 ECPICLEEF--REPVVLLPCGHVFCRSCIDKWLKSgKNTCPLCRTPI 45
zf-RING_2 pfam13639
Ring finger domain;
228-270 3.30e-15

Ring finger domain;


Pssm-ID: 257949  Cd Length: 44  Bit Score: 68.18  E-value: 3.30e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 37622894   228 ECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCR 270
Cdd:pfam13639   2 ECPICLDEFEEGEEVVVLPCGHVFHKECLDKWLRSSPTCPLCR 44
zf-RING_3 pfam14369
zinc-finger;
10-40 5.26e-10

zinc-finger;


Pssm-ID: 258540  Cd Length: 34  Bit Score: 54.10  E-value: 5.26e-10
                          10        20        30
                  ....*....|....*....|....*....|...
gi 37622894    10 RYFCHCCS--VEIVPRLPDYICPRCESGFIEEL 40
Cdd:pfam14369   2 RYWCYQCDrfVRIAPSGDSDVCPRCGGGFVEEI 34
RING smart00184
Ring finger; E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and ...
229-269 1.19e-08

Ring finger; E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)


Pssm-ID: 214546  Cd Length: 40  Bit Score: 50.20  E-value: 1.19e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 37622894    229 CPVCKDDYAlgERVRQLPCNHLFHDGCIVPWLEQHD-SCPVC 269
Cdd:smart00184   1 CPICLEEYL--KDPVILPCGHTFCRSCIRKWLESGNnTCPIC 40
zf-C3HC4_2 pfam13923
Zinc finger, C3HC4 type (RING finger);
229-269 1.08e-07

Zinc finger, C3HC4 type (RING finger);


Pssm-ID: 258185  Cd Length: 39  Bit Score: 47.45  E-value: 1.08e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 37622894   229 CPVCKDDYAlgERVRQLPCNHLFHDGCIVPWLEQHDSCPVC 269
Cdd:pfam13923   1 CPICLDLLK--DPVVLTPCGHVFCRECILRLLKKNKKCPIC 39
zf-C3HC4 pfam00097
Zinc finger, C3HC4 type (RING finger); The C3HC4 type zinc-finger (RING finger) is a ...
229-269 1.15e-05

Zinc finger, C3HC4 type (RING finger); The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid. Many proteins containing a RING finger play a key role in the ubiquitination pathway.


Pssm-ID: 249586  Cd Length: 40  Bit Score: 41.97  E-value: 1.15e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 37622894   229 CPVCKDDYAlgERVRQLPCNHLFHDGCIVPWLE-QHDSCPVC 269
Cdd:pfam00097   1 CPICLEEPK--DPVTLLPCGHLFCSKCIRSWLEsGNVTCPLC 40
APC11 COG5194
Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational ...
229-271 6.39e-05

Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning];


Pssm-ID: 227521  Cd Length: 88  Bit Score: 40.20  E-value: 6.39e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 37622894 229 CPVCKDDYALGER--VRQLPCNHLFHDGCIVPWLEQHDSCPVCRK 271
Cdd:COG5194  34 CPECQFGMTPGDEcpVVWGVCNHAFHDHCIYRWLDTKGVCPLDRQ 78
zf-Apc11 pfam12861
Anaphase-promoting complex subunit 11 RING-H2 finger; Apc11 is one of the subunits of the ...
229-274 1.72e-04

Anaphase-promoting complex subunit 11 RING-H2 finger; Apc11 is one of the subunits of the anaphase-promoting complex or cyclosome. The APC subunits are cullin family proteins with ubiquitin ligase activity. Polyubiquitination marks proteins for degradation by the 26S proteasome and is carried out by a cascade of enzymes that includes ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin ligases (E3s). Apc11 acts as an E3 enzyme and is responsible for recruiting E2s to the APC and for mediating the subsequent transfer of ubiquitin to APC substrates in vivo. In Saccharomyces cerevisiae this RING-H2 finger protein defines the minimal ubiquitin ligase activity of the APC, and the integrity of the RING-H2 finger is essential for budding yeast cell viability.


Pssm-ID: 193335  Cd Length: 85  Bit Score: 39.00  E-value: 1.72e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 37622894   229 CPVCK---DDYAL--GErvrqlpCNHLFHDGCIVPWLEQHDS---CPVCRKSLT 274
Cdd:pfam12861  35 CPQCKfpgDDCPLvwGK------CKHNFHMHCILKWLATETSkglCPMCRQTFV 82
zf-RING_5 pfam14634
zinc-RING finger domain;
228-271 2.78e-04

zinc-RING finger domain;


Pssm-ID: 258772  Cd Length: 41  Bit Score: 37.81  E-value: 2.78e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 37622894   228 ECPVCKDDYAlGERVRQLPCNHLFHDGCIVPWLEQHdsCPVCRK 271
Cdd:pfam14634   1 HCNKCFKPLS-TEPFYLTSCGHIFCEACLSELKEKQ--CPICRK 41
HybF COG0375
Hydrogenase maturation metallochaperone HypA/HybF, involved in Ni insertion [Posttranslational ...
8-36 9.09e-03

Hydrogenase maturation metallochaperone HypA/HybF, involved in Ni insertion [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223452  Cd Length: 115  Bit Score: 34.18  E-value: 9.09e-03
                        10        20
                ....*....|....*....|....*....
gi 37622894   8 PGRYFCHCCSVEIVPRLPDYICPRCESGF 36
Cdd:COG0375  68 PAECWCLDCGQEVELEELDYRCPKCGSIN 96
COG5540 COG5540
RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, ...
219-273 7.69e-11

RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227827 [Multi-domain]  Cd Length: 374  Bit Score: 61.16  E-value: 7.69e-11
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 37622894 219 TEEHvGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQH-DSCPVCRKSL 273
Cdd:COG5540 317 AVEA-DKGVECAICMSNFIKNDRLRVLPCDHRFHVGCVDKWLLGYsNKCPVCRTAI 371
HRD1 COG5243
HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein ...
216-282 7.79e-08

HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227568 [Multi-domain]  Cd Length: 491  Bit Score: 51.89  E-value: 7.79e-08
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 37622894 216 VPVTEEHVGSGLE-CPVCKDDY----------ALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTATNP 282
Cdd:COG5243 276 PTATEEQLTNSDRtCTICMDEMfhpdheplprGLDMTPKRLPCGHILHLHCLKNWLERQQTCPICRRPVIFDQSSPTP 353
zf-rbx1 pfam12678
RING-H2 zinc finger; There are 8 cysteine/ histidine residues which are proposed to be the ...
228-270 2.28e-07

RING-H2 zinc finger; There are 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding. The protein, of which this domain is the conserved region, participates in diverse functions relevant to chromosome metabolizm and cell cycle control.


Pssm-ID: 257215 [Multi-domain]  Cd Length: 73  Bit Score: 47.05  E-value: 2.28e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 37622894   228 ECPVckddyALGErvrqlpCNHLFHDGCIVPWLEQHDSCPVCR 270
Cdd:pfam12678  42 DCPV-----VWGE------CGHAFHLHCISRWLKTRNTCPLCR 73
COG5219 COG5219
Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only];
220-274 1.38e-04

Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only];


Pssm-ID: 227544 [Multi-domain]  Cd Length: 1525  Bit Score: 42.35  E-value: 1.38e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 37622894  220 EEHVGSGLECPVCkddYALGERV-RQLP------CNHLFHDGCIVPWLEQHDS--CPVCRKSLT 274
Cdd:COG5219 1463 DEKFSGHEECAIC---YSVLDMVdRSLPskrcatCKNKFHTRCLYKWFASSARsnCPLCRSEIT 1523
PHA02929 PHA02929
N1R/p28-like protein; Provisional
247-271 2.48e-04

N1R/p28-like protein; Provisional


Pssm-ID: 222944 [Multi-domain]  Cd Length: 238  Bit Score: 40.53  E-value: 2.48e-04
                         10        20
                 ....*....|....*....|....*
gi 37622894  247 CNHLFHDGCIVPWLEQHDSCPVCRK 271
Cdd:PHA02929 200 CNHVFCIECIDIWKKEKNTCPVCRT 224
RAD18 COG5432
RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms];
225-270 8.20e-04

RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms];


Pssm-ID: 227719 [Multi-domain]  Cd Length: 391  Bit Score: 39.30  E-value: 8.20e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 37622894 225 SGLECPVCKDDYalgeRVRQL-PCNHLFHDGCIVPWLEQHDSCPVCR 270
Cdd:COG5432  24 SMLRCRICDCRI----SIPCEtTCGHTFCSLCIRRHLGTQPFCPVCR 66
rad18 TIGR00599
DNA repair protein rad18; All proteins in this family for which functions are known are ...
225-272 1.35e-03

DNA repair protein rad18; All proteins in this family for which functions are known are involved in nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273165 [Multi-domain]  Cd Length: 397  Bit Score: 38.45  E-value: 1.35e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 37622894   225 SGLECPVCKDDYalgeRVRQL-PCNHLFHDGCIVPWLEQHDSCPVCRKS 272
Cdd:TIGR00599  25 TSLRCHICKDFF----DVPVLtSCSHTFCSLCIRRCLSNQPKCPLCRAE 69
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH