NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|221136854|ref|NP_060551.2|]
View 

telomerase Cajal body protein 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 super family cl02567
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 3.98e-32

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


The actual alignment was detected with superfamily member cd00200:

Pssm-ID: 271593 [Multi-domain]  Cd Length: 289  Bit Score: 124.37  E-value: 3.98e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 175 CKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 334 SPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQsgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 221136854 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTDgpgnDGKPEPVLSfLPQKDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDLR----TGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
WD40 COG2319
WD40 repeat [General function prediction only];
240-480 1.33e-23

WD40 repeat [General function prediction only];


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 102.47  E-value: 1.33e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 240 PDTSYVASSSRENPIHIWDAFTGelRASFRAYNHLDELTAAHSLCFSPDGSQLFCG---FNRTVRVFSTARPGRDCevra 316
Cdd:COG2319   75 PDGELLLSGSSDGTIKLWDLDNG--EKLIKSLEGLHDSSVSKLALSSPDGNSILLAsssLDGTVKLWDLSTPGKLI---- 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 317 tfAKKQGQSGIISCIAFSPAQP-LYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCW 395
Cdd:COG2319  149 --RTLEGHSESVTSLAFSPDGKlLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLW 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 396 DLRqSGYPLWSLGREVTTNQRIYFdlDPTGQFLVSGSTSGAVSVWDTDGPGNdgkpePVLSFLPQKDCTNGVSLHPSLPL 475
Cdd:COG2319  227 DLS-TGKLLRSTLSGHSDSVVSSF--SPDGSLLASGSSDGTIRLWDLRSSSS-----LLRTLSGHSSSVLSVAFSPDGKL 298

                 ....*
gi 221136854 476 LATAS 480
Cdd:COG2319  299 LASGS 303
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 3.98e-32

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 124.37  E-value: 3.98e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 175 CKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 334 SPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQsgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 221136854 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTDgpgnDGKPEPVLSfLPQKDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDLR----TGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
356-396 5.57e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 43.84  E-value: 5.57e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 221136854   356 DGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSD-DGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
357-396 1.13e-05

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.12  E-value: 1.13e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 221136854  357 GSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSD-DGTVRVWD 39
WD40 COG2319
WD40 repeat [General function prediction only];
240-480 1.33e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 102.47  E-value: 1.33e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 240 PDTSYVASSSRENPIHIWDAFTGelRASFRAYNHLDELTAAHSLCFSPDGSQLFCG---FNRTVRVFSTARPGRDCevra 316
Cdd:COG2319   75 PDGELLLSGSSDGTIKLWDLDNG--EKLIKSLEGLHDSSVSKLALSSPDGNSILLAsssLDGTVKLWDLSTPGKLI---- 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 317 tfAKKQGQSGIISCIAFSPAQP-LYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCW 395
Cdd:COG2319  149 --RTLEGHSESVTSLAFSPDGKlLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLW 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 396 DLRqSGYPLWSLGREVTTNQRIYFdlDPTGQFLVSGSTSGAVSVWDTDGPGNdgkpePVLSFLPQKDCTNGVSLHPSLPL 475
Cdd:COG2319  227 DLS-TGKLLRSTLSGHSDSVVSSF--SPDGSLLASGSSDGTIRLWDLRSSSS-----LLRTLSGHSSSVLSVAFSPDGKL 298

                 ....*
gi 221136854 476 LATAS 480
Cdd:COG2319  299 LASGS 303
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-491 7.85e-05

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 44.31  E-value: 7.85e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 180 DGSCILTNSADNILRIYNLPpELYHEGEQVEYaemvPVLRMVEGDTIYDYCWYSLMSSAqpdtsyVASSSRENPIHIWDA 259
Cdd:PLN00181 494 DGEFFATAGVNKKIKIFECE-SIIKDGRDIHY----PVVELASRSKLSGICWNSYIKSQ------VASSNFEGVVQVWDV 562
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 260 FTGELRASFRAYNHldeltaahslcfspdgsqlfcgfnrtvRVFStarpgrdcevratfakkqgqsgiiscIAFSPAQP- 338
Cdd:PLN00181 563 ARSQLVTEMKEHEK---------------------------RVWS--------------------------IDYSSADPt 589
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 339 LYACGSYGRSLGLYAWDDGSPLALLGGhQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSL-GREVTTNQRI 417
Cdd:PLN00181 590 LLASGSDDGSVKLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMiGHSKTVSYVR 668
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 418 YFDldptGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASG-------QRVFPEPTE 490
Cdd:PLN00181 669 FVD----SSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSEtnevfvyHKAFPMPVL 744

                 .
gi 221136854 491 S 491
Cdd:PLN00181 745 S 745
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 3.98e-32

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 124.37  E-value: 3.98e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 175 CKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 334 SPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQsgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 221136854 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTDgpgnDGKPEPVLSfLPQKDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDLR----TGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
146-441 4.05e-32

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 124.37  E-value: 4.05e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 146 WNYSFSQLPRFLSGswsefstqPENFLKGCKWAPDGSCILTNSADNILRIYNLppelyhegeqveyaEMVPVLRMVEGDT 225
Cdd:cd00200   36 WDLETGELLRTLKG--------HTGPVRDVAASADGTYLASGSSDKTIRLWDL--------------ETGECVRTLTGHT 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 226 IYdycWYSLMSSaqPDTSYVASSSRENPIHIWDAFTGELRASFRAynHLDeltAAHSLCFSPDGSQLFCG-FNRTVRVFS 304
Cdd:cd00200   94 SY---VSSVAFS--PDGRILSSSSRDKTIKVWDVETGKCLTTLRG--HTD---WVNSVAFSPDGTFVASSsQDGTIKLWD 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 305 TarpgRDCEVRATFakkQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGnRFFS 384
Cdd:cd00200  164 L----RTGKCVATL---TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDG-YLLA 235
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 221136854 385 GARKDAELLCWDLRqsgyplwsLGREVTT----NQRIY-FDLDPTGQFLVSGSTSGAVSVWD 441
Cdd:cd00200  236 SGSEDGTIRVWDLR--------TGECVQTlsghTNSVTsLAWSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
322-480 5.01e-16

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 77.38  E-value: 5.01e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 322 QGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGArKDAELLCWDLRQsg 401
Cdd:cd00200    6 KGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGS-SDKTIRLWDLET-- 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 402 yplwslGREVTT----NQRIY-FDLDPTGQFLVSGSTSGAVSVWDTDgpgndgKPEPVLSFLPQKDCTNGVSLHPSLPLL 476
Cdd:cd00200   83 ------GECVRTltghTSYVSsVAFSPDGRILSSSSRDKTIKVWDVE------TGKCLTTLRGHTDWVNSVAFSPDGTFV 150

                 ....
gi 221136854 477 ATAS 480
Cdd:cd00200  151 ASSS 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
143-304 5.56e-11

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 62.35  E-value: 5.56e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 143 DTAWNYSFSQLPRFLSGS--------WSEFSTQPENFLKG-------CKWAPDGSCILTNSADNILRIYNLppelyHEGE 207
Cdd:cd00200  136 DWVNSVAFSPDGTFVASSsqdgtiklWDLRTGKCVATLTGhtgevnsVAFSPDGEKLLSSSSDGTIKLWDL-----STGK 210
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 208 QVEyaemvpVLRmveGDTiyDYCWySLMSSaqPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHldeltAAHSLCFSP 287
Cdd:cd00200  211 CLG------TLR---GHE--NGVN-SVAFS--PDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTN-----SVTSLAWSP 271
                        170
                 ....*....|....*...
gi 221136854 288 DGSQLF-CGFNRTVRVFS 304
Cdd:cd00200  272 DGKRLAsGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
363-483 2.51e-09

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 57.34  E-value: 2.51e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 363 LGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLrQSGYPLWSLgrEVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDT 442
Cdd:cd00200    5 LKGHTGGVTCVAFSPDGKLLATGSG-DGTIKVWDL-ETGELLRTL--KGHTGPVRDVAASADGTYLASGSSDKTIRLWDL 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 221136854 443 DgpgndgKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQR 483
Cdd:cd00200   81 E------TGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDK 115
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
356-396 5.57e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 43.84  E-value: 5.57e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 221136854   356 DGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSD-DGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
357-396 1.13e-05

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.12  E-value: 1.13e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 221136854  357 GSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSD-DGTVRVWD 39
WD40 COG2319
WD40 repeat [General function prediction only];
240-480 1.33e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 102.47  E-value: 1.33e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 240 PDTSYVASSSRENPIHIWDAFTGelRASFRAYNHLDELTAAHSLCFSPDGSQLFCG---FNRTVRVFSTARPGRDCevra 316
Cdd:COG2319   75 PDGELLLSGSSDGTIKLWDLDNG--EKLIKSLEGLHDSSVSKLALSSPDGNSILLAsssLDGTVKLWDLSTPGKLI---- 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 317 tfAKKQGQSGIISCIAFSPAQP-LYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCW 395
Cdd:COG2319  149 --RTLEGHSESVTSLAFSPDGKlLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASGSSDGTIRLW 226
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 396 DLRqSGYPLWSLGREVTTNQRIYFdlDPTGQFLVSGSTSGAVSVWDTDGPGNdgkpePVLSFLPQKDCTNGVSLHPSLPL 475
Cdd:COG2319  227 DLS-TGKLLRSTLSGHSDSVVSSF--SPDGSLLASGSSDGTIRLWDLRSSSS-----LLRTLSGHSSSVLSVAFSPDGKL 298

                 ....*
gi 221136854 476 LATAS 480
Cdd:COG2319  299 LASGS 303
WD40 COG2319
WD40 repeat [General function prediction only];
137-482 1.46e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 102.47  E-value: 1.46e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 137 AAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELyhegeqveyaEMVP 216
Cdd:COG2319   33 LGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE----------KLIK 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 217 VLRMVEGDTIYDYCWYSLMSsaqpDTSYVASSSRENPIHIWDaFTGELRASFRAYNHLDELTaahSLCFSPDGSQLFCG- 295
Cdd:COG2319  103 SLEGLHDSSVSKLALSSPDG----NSILLASSSLDGTVKLWD-LSTPGKLIRTLEGHSESVT---SLAFSPDGKLLASGs 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 296 -FNRTVRVFSTARPgrdcEVRATFAkkqGQSGIISCIAFSPAQPLY-ACGSYGRSLGLYAWDDGSPLA-LLGGHQGGITH 372
Cdd:COG2319  175 sLDGTIKLWDLRTG----KPLSTLA---GHTDPVSSLAFSPDGGLLiASGSSDGTIRLWDLSTGKLLRsTLSGHSDSVVS 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 373 lCFHPDGNRFFSGARkDAELLCWDLRQSGYPLWSLGREvttNQRIY-FDLDPTGQFLVSGSTSGAVSVWDTDGpgndGKP 451
Cdd:COG2319  248 -SFSPDGSLLASGSS-DGTIRLWDLRSSSSLLRTLSGH---SSSVLsVAFSPDGKLLASGSSDGTVRLWDLET----GKL 318
                        330       340       350
                 ....*....|....*....|....*....|.
gi 221136854 452 EPVLSFLPQKDCTNGVSLHPSLPLLATASGQ 482
Cdd:COG2319  319 LSSLTLKGHEGPVSSLSFSPDGSLLVSGGSD 349
WD40 COG2319
WD40 repeat [General function prediction only];
168-480 3.75e-20

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 92.07  E-value: 3.75e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 168 PENFLKGCKWAPDGSCILTNS-ADNILRIYNLPPElyhegeqveyaemvPVLRMVEGDTiydyCWYSLMSSAQPDTSYVA 246
Cdd:COG2319  154 HSESVTSLAFSPDGKLLASGSsLDGTIKLWDLRTG--------------KPLSTLAGHT----DPVSSLAFSPDGGLLIA 215
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 247 SSSRENPIHIWDAFTGELRASfraynHLDELTAAHSLCFSPDGSQLFCGF-NRTVRVFSTARPGRDcevratFAKKQGQS 325
Cdd:COG2319  216 SGSSDGTIRLWDLSTGKLLRS-----TLSGHSDSVVSSFSPDGSLLASGSsDGTIRLWDLRSSSSL------LRTLSGHS 284
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 326 GIISCIAFSPAQPLYACGSYGRSLGLyaWDDGSPLAL----LGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRqSG 401
Cdd:COG2319  285 SSVLSVAFSPDGKLLASGSSDGTVRL--WDLETGKLLssltLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLR-TG 361
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 221136854 402 YPLWSLGREVTTNQriyFDLDPTGQFLVSGSTSGAVSVWDTDgpgndgKPEPVLSFLPQKDCTNGVSLHPSLPLLATAS 480
Cdd:COG2319  362 KPLKTLEGHSNVLS---VSFSPDGRVVSSGSTDGTVRLWDLS------TGSLLRNLDGHTSRVTSLDFSPDGKSLASGS 431
WD40 COG2319
WD40 repeat [General function prediction only];
131-444 4.26e-19

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 88.99  E-value: 4.26e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 131 DTSGEPAAEDEGDTAWNYSFSQLP---RFLSGS--------WSEFSTQPENFLKG-------CKWAPDGSC-ILTNSADN 191
Cdd:COG2319  142 STPGKLIRTLEGHSESVTSLAFSPdgkLLASGSsldgtiklWDLRTGKPLSTLAGhtdpvssLAFSPDGGLlIASGSSDG 221
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 192 ILRIYNLppelyHEGEQVEyaemvpvlrmvegdTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGElRASFRAY 271
Cdd:COG2319  222 TIRLWDL-----STGKLLR--------------STLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSS-SLLRTLS 281
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 272 NHLDELTaahSLCFSPDGSQLFCGFN-RTVRVFSTARPGRDCEVratfaKKQGQSGIISCIAFSP-AQPLYACGSYGRSL 349
Cdd:COG2319  282 GHSSSVL---SVAFSPDGKLLASGSSdGTVRLWDLETGKLLSSL-----TLKGHEGPVSSLSFSPdGSLLVSGGSDDGTI 353
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 350 GLYAWDDGSPLALLGGHqGGITHLCFHPDGnRFFSGARKDAELLCWDLRQSGyplwSLGREVTTNQRIY-FDLDPTGQFL 428
Cdd:COG2319  354 RLWDLRTGKPLKTLEGH-SNVLSVSFSPDG-RVVSSGSTDGTVRLWDLSTGS----LLRNLDGHTSRVTsLDFSPDGKSL 427
                        330
                 ....*....|....*.
gi 221136854 429 VSGSTSGAVSVWDTDG 444
Cdd:COG2319  428 ASGSSDNTIRLWDLKT 443
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-491 7.85e-05

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 44.31  E-value: 7.85e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 180 DGSCILTNSADNILRIYNLPpELYHEGEQVEYaemvPVLRMVEGDTIYDYCWYSLMSSAqpdtsyVASSSRENPIHIWDA 259
Cdd:PLN00181 494 DGEFFATAGVNKKIKIFECE-SIIKDGRDIHY----PVVELASRSKLSGICWNSYIKSQ------VASSNFEGVVQVWDV 562
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 260 FTGELRASFRAYNHldeltaahslcfspdgsqlfcgfnrtvRVFStarpgrdcevratfakkqgqsgiiscIAFSPAQP- 338
Cdd:PLN00181 563 ARSQLVTEMKEHEK---------------------------RVWS--------------------------IDYSSADPt 589
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 339 LYACGSYGRSLGLYAWDDGSPLALLGGhQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSL-GREVTTNQRI 417
Cdd:PLN00181 590 LLASGSDDGSVKLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMiGHSKTVSYVR 668
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221136854 418 YFDldptGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASG-------QRVFPEPTE 490
Cdd:PLN00181 669 FVD----SSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSEtnevfvyHKAFPMPVL 744

                 .
gi 221136854 491 S 491
Cdd:PLN00181 745 S 745
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH