NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7839206|ref|NP_058192|]
View 

gag protein [Saccharomyces cerevisiae S288c]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.63e-53

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 144563  Cd Length: 98  Bit Score: 175.24  E-value: 2.63e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839206     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.63e-53

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 175.24  E-value: 2.63e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839206     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
Med15 pfam09606
ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of ...
4-171 1.51e-03

ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, Med15 is a critical transducer of gene activation signals that control early metazoan development.


Pssm-ID: 255446 [Multi-domain]  Cd Length: 768  Bit Score: 39.61  E-value: 1.51e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206      4 QQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNG 83
Cdd:pfam09606 369 HQQQMNQQVGQGGQMVALGYLNIQGNQGGLGANPMQQGQPGMMSSPSPVPQVQTNQSMPQPPQPSVPSPGGPGSQPPQSV 448
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     84 PypqqcmmtqNQANPSGwsfyghPSMIPYTPYQMSPMyfpPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMT 163
Cdd:pfam09606 449 S---------GGMIPSP------PALMPSPSPQMSQS---PASQRTIQQDMVSPGGPLNTPGQSSVNSPANPQEEQLYRE 510
                         170
                  ....*....|.
gi 7839206    164 STK---KYVRP 171
Cdd:pfam09606 511 KYKqlsKYIEP 521
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 2.63e-53

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 175.24  E-value: 2.63e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839206     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
Med15 pfam09606
ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of ...
4-171 1.51e-03

ARC105 or Med15 subunit of Mediator complex non-fungal; The approx. 70 residue Med15 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, Med15 is a critical transducer of gene activation signals that control early metazoan development.


Pssm-ID: 255446 [Multi-domain]  Cd Length: 768  Bit Score: 39.61  E-value: 1.51e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206      4 QQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNG 83
Cdd:pfam09606 369 HQQQMNQQVGQGGQMVALGYLNIQGNQGGLGANPMQQGQPGMMSSPSPVPQVQTNQSMPQPPQPSVPSPGGPGSQPPQSV 448
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     84 PypqqcmmtqNQANPSGwsfyghPSMIPYTPYQMSPMyfpPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMT 163
Cdd:pfam09606 449 S---------GGMIPSP------PALMPSPSPQMSQS---PASQRTIQQDMVSPGGPLNTPGQSSVNSPANPQEEQLYRE 510
                         170
                  ....*....|.
gi 7839206    164 STK---KYVRP 171
Cdd:pfam09606 511 KYKqlsKYIEP 521
DUF605 pfam04652
Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ...
36-170 5.36e-03

Vta1 like; Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region.


Pssm-ID: 252721 [Multi-domain]  Cd Length: 312  Bit Score: 37.35  E-value: 5.36e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839206     36 SASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNgPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPY 115
Cdd:pfam04652 151 GPPLDEEDEDALANLDPSFFGEDAGPASASPSDPPSSSPGEPSFPSP-PEGPDSPSDSSLPPAPSSFQSDTPPSSPEEPT 229
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7839206    116 QMSPmyfppgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSA--------DSDMTSTKKYVR 170
Cdd:pfam04652 230 NPSP------PPSPFAPSPPPQQQVPPLSTAKPSPPHTSATPApigpitpdDDAIAKAQKHAK 286
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH