NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6323689|ref|NP_013760|]
View 

gag protein [Saccharomyces cerevisiae S288c]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 1.21e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 144563  Cd Length: 98  Bit Score: 173.70  E-value: 1.21e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     17 ACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPLSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 6323689     97 NISGWPVYGHPSLMPYPP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 1.21e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 173.70  E-value: 1.21e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     17 ACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPLSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 6323689     97 NISGWPVYGHPSLMPYPP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
49-172 1.50e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 39.37  E-value: 1.50e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     49 QANSQQPTTPLSSAVPENHHhasPQAAQVPLPQ--NGPYPQQRMMNTQQANISGW----PVYGHPSLMPYPPYQMSPMYA 122
Cdd:pfam09770 221 PAPSQAPAQPPLPPQLPQQP---PPLQQPQFPGlsQQMPPPPPQPPQQQQQPPQPqaqpPPQNQPTPHPGLPQGQNAPLP 297
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 6323689    123 PPGAQSQFTQypqyvgtHLNTPSPESGNSFPDsssakSNMTSTNQHVRPP 172
Cdd:pfam09770 298 PPQQPQLLPL-------VQQPQGQQRGPQFRE-----QLVQLSQQQREAL 335
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 1.21e-52

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 144563  Cd Length: 98  Bit Score: 173.70  E-value: 1.21e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     17 ACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPLSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQA 96
Cdd:pfam01021   1 ACASVTSKEVHTNQDPLDVSASKLPEYDKDSTKANSQQETTPGSSAVPENHHHASPQTAQVPLPQNGPYQQQCMMTPNQA 80
                          90
                  ....*....|....*...
gi 6323689     97 NISGWPVYGHPSLMPYPP 114
Cdd:pfam01021  81 NPSGWSVYGHPSMMPYTP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
49-172 1.50e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 39.37  E-value: 1.50e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     49 QANSQQPTTPLSSAVPENHHhasPQAAQVPLPQ--NGPYPQQRMMNTQQANISGW----PVYGHPSLMPYPPYQMSPMYA 122
Cdd:pfam09770 221 PAPSQAPAQPPLPPQLPQQP---PPLQQPQFPGlsQQMPPPPPQPPQQQQQPPQPqaqpPPQNQPTPHPGLPQGQNAPLP 297
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|
gi 6323689    123 PPGAQSQFTQypqyvgtHLNTPSPESGNSFPDsssakSNMTSTNQHVRPP 172
Cdd:pfam09770 298 PPQQPQLLPL-------VQQPQGQQRGPQFRE-----QLVQLSQQQREAL 335
SSDP pfam04503
Single-stranded DNA binding protein, SSDP; This is a family of eukaryotic single-stranded DNA ...
53-183 4.61e-03

Single-stranded DNA binding protein, SSDP; This is a family of eukaryotic single-stranded DNA binding proteins with specificity to a pyrimidine-rich element found in the promoter region of the alpha2(I) collagen gene.


Pssm-ID: 252636 [Multi-domain]  Cd Length: 293  Bit Score: 37.39  E-value: 4.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     53 QQPTTPLSSAVPENHHHASpQAAQVPLPQNGPYPQQRMMNTQQANISG---------WPVY---GHPSL---MPY--PPY 115
Cdd:pfam04503  50 QQKKTPQSGSTPQMQNTTS-QPFMSPRYPGGPRPPLRMPNQPPGGVPGsqpllpggmDPTVrqqGHPNMggpMQRmtPPR 128
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689    116 QMSPMYAPPGAQSQFTQYPQYVGTHLNT------------PSPESGNSFPDSSSAKSNMTSTNQHVRPP--PILTSPNDF 181
Cdd:pfam04503 129 GMKSLDGPQNYGGGMRPPPNSLLGPAMPgmnmgpglgrpwPNPISANSIPYSSSSPGEYTGPPGGGGPPgtPIMPSPADS 208

                  ..
gi 6323689    182 LN 183
Cdd:pfam04503 209 TN 210
TFIIA pfam03153
Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a ...
59-181 6.11e-03

Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription.


Pssm-ID: 251762 [Multi-domain]  Cd Length: 302  Bit Score: 37.04  E-value: 6.11e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6323689     59 LSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQanisgwpvygHPSLMPYPPYQMSPMYAPPGAQSQFTQYPQYVG 138
Cdd:pfam03153  40 SQSGVAEFPWDPSPPAPPPPLQLPQPLPPPPQAPPAL----------QALPAGDAQQHNTPTSSPAAAPPAAFATPAGMG 109
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 6323689    139 tHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPNDF 181
Cdd:pfam03153 110 -AGPTIQTPPGQLYQVNVPVMVNQNSANSQLAQPAQERAAQQL 151
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH