NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|146219843|ref|NP_006653|]
View 

helicase SRCAP [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
2036-2164 1.48e-28

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


:

Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 114.64  E-value: 1.48e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2036 RLIQYDCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKriFCFI 2115
Cdd:cd00079     5 YVLPVEDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPGIKVAALHGDGSQEEREEVLKDFREGE--IVVL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 2116 LSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIY 2164
Cdd:cd00079    83 VATDVIARGIDLPNVSVVINYDLPWSPSSYLQRIGRAGRAGQKGTAILL 131
DEXDc cd00046
DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or ...
638-777 5.52e-23

DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


:

Pssm-ID: 238005  Cd Length: 144  Bit Score: 98.95  E-value: 5.52e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  638 NGILADEMGLGKTIQTISLLAHlACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTYYGAQKERKLKRQGWTKP 715
Cdd:cd00046     2 DVLLAAPTGSGKTLAALLPILE-LLDSLKGGQVLVLAPTRELANQVAERLKELFGEgiKVGYLIGGTSIKQQEKLLSGKT 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 146219843  716 nafHVCITSYKLVLQDHQ--AFRRKNWRYLILDEAQNIKN---FKSQRWQSLLNFNSQRRLLLTGTP 777
Cdd:cd00046    81 ---DIVVGTPGRLLDELErlKLSLKKLDLLILDEAHRLLNqgfGLLGLKILLKLPKDRQVLLLSATP 144
HSA pfam07529
HSA; This domain is predicted to bind DNA and is often found associated with helicases.
125-196 1.74e-24

HSA; This domain is predicted to bind DNA and is often found associated with helicases.


:

Pssm-ID: 254265  Cd Length: 73  Bit Score: 101.23  E-value: 1.74e-24
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843   125 PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERAR-REEQAKLRRIAS 196
Cdd:pfam07529    1 QRLEEEQREKTHWDHLLEEMLWMSKDFREERKWKIAKAKKLARAVAQYHKYIEKEEQRRKeREAKERLKALKA 73
SNF2_N pfam00176
SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of ...
621-907 1.83e-100

SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).


:

Pssm-ID: 249654 [Multi-domain]  Cd Length: 286  Bit Score: 328.09  E-value: 1.83e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   621 YQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTY 698
Cdd:pfam00176    1 YQLEGVNWMIRLENNGNGGILADEMGLGKTLQTIALIAYLKEEAPRGGPTLIVVPLSLLDNWLNEFEKWAPPDtlRVLVY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   699 YGAQKERKLKRQGwTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPL 778
Cdd:pfam00176   81 DGTNSYEARKQFQ-NKLRDYDVVITTYEVLRKDKSVLKKIKWDRVVLDEGHRLKNSQSKLYEALNKLRTRNRLILTGTPI 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   779 QNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTgmiegsQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIR 858
Cdd:pfam00176  160 QNNLAELWSLLNFLRPGPFGSREDFDNWFSRPIA------EELGKEGLNRLHKLLKPFLLRRTKSDVEKSLPPKTEHILF 233
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|...
gi 146219843   859 CRLSKRQRCLYDDFMAQTTTKETLATGH----FMSVINILMQLRKVCNHPNLF 907
Cdd:pfam00176  234 VNLSDEQRKLYNKLLTKSRLAINLVNNEikggKSSILNLIMELRKICNHPYLF 286
DUF3432 pfam11914
Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. ...
1377-1460 4.33e-03

Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 100 amino acids in length. This domain is found associated with pfam00096. This domain has two conserved sequence motifs: YPSPV and PSP.


:

Pssm-ID: 152349 [Multi-domain]  Cd Length: 100  Bit Score: 38.58  E-value: 4.33e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1377 LVHSPSPEVSASAPGA-----APLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPA 1451
Cdd:pfam11914    6 PVSTASPNISIYSSSPvssypSPIATSYPSPVPTSYSSPVSSCYPSPVHTSFPSPSIATTYPSVSPTFQTQVATSFPSSV 85
                           90
                   ....*....|....
gi 146219843  1452 -----SAPLTIPIS 1460
Cdd:pfam11914   86 vtnsfSSPVTTPLS 99
 
Name Accession Description Interval E-value
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
2036-2164 1.48e-28

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 114.64  E-value: 1.48e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2036 RLIQYDCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKriFCFI 2115
Cdd:cd00079     5 YVLPVEDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPGIKVAALHGDGSQEEREEVLKDFREGE--IVVL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 2116 LSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIY 2164
Cdd:cd00079    83 VATDVIARGIDLPNVSVVINYDLPWSPSSYLQRIGRAGRAGQKGTAILL 131
DEXDc cd00046
DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or ...
638-777 5.52e-23

DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 238005  Cd Length: 144  Bit Score: 98.95  E-value: 5.52e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  638 NGILADEMGLGKTIQTISLLAHlACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTYYGAQKERKLKRQGWTKP 715
Cdd:cd00046     2 DVLLAAPTGSGKTLAALLPILE-LLDSLKGGQVLVLAPTRELANQVAERLKELFGEgiKVGYLIGGTSIKQQEKLLSGKT 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 146219843  716 nafHVCITSYKLVLQDHQ--AFRRKNWRYLILDEAQNIKN---FKSQRWQSLLNFNSQRRLLLTGTP 777
Cdd:cd00046    81 ---DIVVGTPGRLLDELErlKLSLKKLDLLILDEAHRLLNqgfGLLGLKILLKLPKDRQVLLLSATP 144
HSA pfam07529
HSA; This domain is predicted to bind DNA and is often found associated with helicases.
125-196 1.74e-24

HSA; This domain is predicted to bind DNA and is often found associated with helicases.


Pssm-ID: 254265  Cd Length: 73  Bit Score: 101.23  E-value: 1.74e-24
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843   125 PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERAR-REEQAKLRRIAS 196
Cdd:pfam07529    1 QRLEEEQREKTHWDHLLEEMLWMSKDFREERKWKIAKAKKLARAVAQYHKYIEKEEQRRKeREAKERLKALKA 73
HELICc smart00490
helicase superfamily c-terminal domain;
2073-2156 1.16e-22

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 96.13  E-value: 1.16e-22
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   2073 DVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRifCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRC 2152
Cdd:smart00490    1 EELAELLKELGIKVARLHGGLSQEEREEILDKFNNGKI--KVLVATDVAERGLDLPGVDLVIIYDLPWSPASYIQRIGRA 78

                    ....
gi 146219843   2153 HRIG 2156
Cdd:smart00490   79 GRAG 82
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
2077-2156 1.03e-21

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 249733  Cd Length: 78  Bit Score: 93.35  E-value: 1.03e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2077 QFLTYHGHLYLRLDGSTRVEQRQALMERFNADKriFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIG 2156
Cdd:pfam00271    1 KLLRKPGIKVARLHGGLSQEEREEILEDFRNGK--SKVLVATDVAGRGIDLPDVNVVINYDLPWNPESYIQRIGRAGRAG 78
HSA smart00573
domain in helicases and associated with SANT domains;
125-196 6.16e-21

domain in helicases and associated with SANT domains;


Pssm-ID: 214727  Cd Length: 73  Bit Score: 90.92  E-value: 6.16e-21
                            10        20        30        40        50        60        70
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843    125 PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEER-ARREEQAKLRRIAS 196
Cdd:smart00573    1 QKLEEERRRKQHWDHLLEEMIWHAKDFKEEHKWKIAAAKKMAKAVMDYHQNKEKEEERrEEKNEKRRLRKLAA 73
SNF2_N pfam00176
SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of ...
621-907 1.83e-100

SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).


Pssm-ID: 249654 [Multi-domain]  Cd Length: 286  Bit Score: 328.09  E-value: 1.83e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   621 YQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTY 698
Cdd:pfam00176    1 YQLEGVNWMIRLENNGNGGILADEMGLGKTLQTIALIAYLKEEAPRGGPTLIVVPLSLLDNWLNEFEKWAPPDtlRVLVY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   699 YGAQKERKLKRQGwTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPL 778
Cdd:pfam00176   81 DGTNSYEARKQFQ-NKLRDYDVVITTYEVLRKDKSVLKKIKWDRVVLDEGHRLKNSQSKLYEALNKLRTRNRLILTGTPI 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   779 QNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTgmiegsQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIR 858
Cdd:pfam00176  160 QNNLAELWSLLNFLRPGPFGSREDFDNWFSRPIA------EELGKEGLNRLHKLLKPFLLRRTKSDVEKSLPPKTEHILF 233
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|...
gi 146219843   859 CRLSKRQRCLYDDFMAQTTTKETLATGH----FMSVINILMQLRKVCNHPNLF 907
Cdd:pfam00176  234 VNLSDEQRKLYNKLLTKSRLAINLVNNEikggKSSILNLIMELRKICNHPYLF 286
DUF3432 pfam11914
Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. ...
1377-1460 4.33e-03

Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 100 amino acids in length. This domain is found associated with pfam00096. This domain has two conserved sequence motifs: YPSPV and PSP.


Pssm-ID: 152349 [Multi-domain]  Cd Length: 100  Bit Score: 38.58  E-value: 4.33e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1377 LVHSPSPEVSASAPGA-----APLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPA 1451
Cdd:pfam11914    6 PVSTASPNISIYSSSPvssypSPIATSYPSPVPTSYSSPVSSCYPSPVHTSFPSPSIATTYPSVSPTFQTQVATSFPSSV 85
                           90
                   ....*....|....
gi 146219843  1452 -----SAPLTIPIS 1460
Cdd:pfam11914   86 vtnsfSSPVTTPLS 99
PLN03142 PLN03142
Probable chromatin-remodeling complex ATPase chain; Provisional
611-918 6.39e-92

Probable chromatin-remodeling complex ATPase chain; Provisional


Pssm-ID: 215601 [Multi-domain]  Cd Length: 1033  Bit Score: 326.37  E-value: 6.39e-92
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  611 PLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWC 690
Cdd:PLN03142  163 PSCIKGKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLGYLHEYRGITGPHMVVAPKSTLGNWMNEIRRFC 242
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  691 PSFKILTYYGAQKERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRR 770
Cdd:PLN03142  243 PVLRAVKFHGNPEERAHQREELLVAGKFDVCVTSFEMAIKEKTALKRFSWRYIIIDEAHRIKNENSLLSKTMRLFSTNYR 322
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  771 LLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNpltgmieGSQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMP 850
Cdd:PLN03142  323 LLITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQI-------SGENDQQEVVQQLHKVLRPFLLRRLKSDVEKGLP 395
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146219843  851 KKYEHVIRCRLSKRQRCLYDDFMaQTTTKETLATGHFMSVINILMQLRKVCNHPNLF---DPRPvtsPFIT 918
Cdd:PLN03142  396 PKKETILKVGMSQMQKQYYKALL-QKDLDVVNAGGERKRLLNIAMQLRKCCNHPYLFqgaEPGP---PYTT 462
HepA COG0553
Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, ...
552-949 3.77e-75

Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223627 [Multi-domain]  Cd Length: 866  Bit Score: 271.99  E-value: 3.77e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  552 EYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLVT 631
Cdd:COG0553   273 EDLFARLRLLDPLRLADLSQILEKFVRETLKLSARDLKDELKELLAELRLSEDLLNAPEPVDLSAELRPYQLEGVNWLSE 352
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  632 M-YEKKLNGILADEMGLGKTIQTISLLAHLACE-KGNWGPHLIIVPTSVMLNWEMELKRWCPSFK-ILTYYGAQKERKLK 708
Cdd:COG0553   353 LlRSNLLGGILADDMGLGKTVQTIALLLSLLESiKVYLGPALIVVPASLLSNWKREFEKFAPDLRlVLVYHGEKSELDKK 432
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  709 RQGW------TKPNAFHVCITSYKLV---LQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQ 779
Cdd:COG0553   433 REALrdllklHLVIIFDVVITTYELLrrfLVDHGGLKKIEWDRVVLDEAHRIKNDQSSEGKALQFLKALNRLDLTGTPLE 512
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  780 NSLMELWSLM-HFLMPHVF-QSHREFKEWFSNPLTGMIE-GSQEYNEGLVKRLHKVLRPFLLRRVK--VDVEKQMPKKYE 854
Cdd:COG0553   513 NRLGELWSLLqEFLNPGLLgTSFAIFTRLFEKPIQAEEDiGPLEARELGIELLRKLLSPFILRRTKedVEVLKELPPKIE 592
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  855 HVIRCRLSKRQRCLYDDFM-----AQTTTKETLATG--------HFMSVINILMQLRKVCNHPNLFDPRPVTSPfitPGI 921
Cdd:COG0553   593 KVLECELSEEQRELYEALLegaekNQQLLEDLEKADsdenrigdSELNILALLTRLRQICNHPALVDEGLEATF---DRI 669
                         410       420
                  ....*....|....*....|....*...
gi 146219843  922 CFSTASLVLRATDVHPLQRIDMGRFDLI 949
Cdd:COG0553   670 VLLLREDKDFDYLKKPLIQLSKGKLQAL 697
PLN03142 PLN03142
Probable chromatin-remodeling complex ATPase chain; Provisional
2043-2212 5.71e-50

Probable chromatin-remodeling complex ATPase chain; Provisional


Pssm-ID: 215601 [Multi-domain]  Cd Length: 1033  Bit Score: 194.25  E-value: 5.71e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2043 GKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNAD-KRIFCFILSTRSG 2121
Cdd:PLN03142  471 GKMVLLDKLLPKLKERDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGEDRDASIDAFNKPgSEKFVFLLSTRAG 550
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2122 GVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTtayf 2201
Cdd:PLN03142  551 GLGINLATADIVILYDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTEYTIEEKVIERAYKKLALDALVIQQGRLA---- 626
                         170
                  ....*....|...
gi 146219843 2202 KQQTIR--ELFDM 2212
Cdd:PLN03142  627 EQKTVNkdELLQM 639
HepA COG0553
Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, ...
2037-2212 1.40e-45

Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223627 [Multi-domain]  Cd Length: 866  Bit Score: 179.16  E-value: 1.40e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2037 LIQYDCGKLQTLAVLLR-QLKAEGH--RVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRIFC 2113
Cdd:COG0553   686 LIQLSKGKLQALDELLLdKLLEEGHyhKVLIFSQFTPVLDLLEDYLKALGIKYVRLDGSTPAKRRQELIDRFNADEEEKV 765
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2114 FILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMAIEG 2193
Cdd:COG0553   766 FLLSLKAGGLGLNLTGADTVILFDPWWNPAVELQAIDRAHRIGQKRPVKVYRLITRGTIEEKILELQEKKQELLDSLIDA 845
                         170       180
                  ....*....|....*....|
gi 146219843 2194 GNFTTAY-FKQQTIRELFDM 2212
Cdd:COG0553   846 EGEKELSkLSIEDLLDLFSL 865
DEXDc smart00487
DEAD-like helicases superfamily;
610-790 1.98e-27

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 113.74  E-value: 1.98e-27
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843    610 IPLLLRGQLREYQHIGLDWlvtMYEKKLNGILADEMGLGKTIQ-TISLLAHLAceKGNWGPHLIIVPT-SVMLNWEMELK 687
Cdd:smart00487    1 IEKFGFEPLRPYQKEAIEA---LLSGLRDVILAAPTGSGKTLAaLLPALEALK--RGKGGRVLVLVPTrELAEQWAEELK 75
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843    688 RWCPSF--KILTYYGAQKERKLKRQgWTKpNAFHVCITSYKLVLQD--HQAFRRKNWRYLILDEAQNIKN--FKSQrWQS 761
Cdd:smart00487   76 KLGPSLglKVVGLYGGDSKREQLRK-LES-GKTDILVTTPGRLLDLleNDKLSLSNVDLVILDEAHRLLDggFGDQ-LEK 152
                           170       180       190
                    ....*....|....*....|....*....|.
gi 146219843    762 LLNF--NSQRRLLLTGTPLQNSLMELWSLMH 790
Cdd:smart00487  153 LLKLlpKNVQLLLLSATPPEEIENLLELFLN 183
PHA03247 PHA03247
large tegument protein UL36; Provisional
1366-1834 7.97e-21

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 100.40  E-value: 7.97e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1366 PTPtlvrPLLKLVHSPSPEVSASAPGAAPL----TISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPI 1441
Cdd:PHA03247 2551 PPP----PLPPAAPPAAPDRSVPPPRPAPRpsepAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDP 2626
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1442 SVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATapSLSSSQTP 1521
Cdd:PHA03247 2627 PPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLT--SLADPPPP 2704
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1522 GHPLLLAPTSShVPGLNSTVAPACSPVLVPASALASPFPSAPN----PAPAQASLLAPASSASQALATPLAPMAAPQTAI 1597
Cdd:PHA03247 2705 PPTPEPAPHAL-VSATPLPPGPAAARQASPALPAAPAPPAVPAgpatPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRL 2783
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1598 LAPSPAPPLAPLPVLAPSPGAAPVlassqtPVPVMAPSSTPGTSLASASPVPAPTPvlapsstqtmlPAPVPSPLPSPAS 1677
Cdd:PHA03247 2784 TRPAVASLSESRESLPSPWDPADP------PAAVLAPAAALPPAASPAGPLPPPTS-----------AQPTAPPPPPGPP 2846
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1678 TQTLALAPALAPtlGGSSPSQtlslgtGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAP--GPPLGPTQTLSLAPAPPLA 1755
Cdd:PHA03247 2847 PPSLPLGGSVAP--GGDVRRR------PPSRSPAAKPAAPARPPVRRLARPAVSRSTESfaLPPDQPERPPQPQAPPPPQ 2918
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146219843 1756 PASPVGPAPAHTLTLAPASSSASLLAPasvqTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLP 1834
Cdd:PHA03247 2919 PQPQPPPPPQPQPPPPPPPRPQPPLAP----TTDPAGAGEPSGAVPQPWLGALVPGRVAVPRFRVPQPAPSREAPASST 2993
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
1442-1865 3.58e-12

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 70.96  E-value: 3.58e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1442 SVPTTLPAPASAPLTIPISAPLT-VSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGaspsasalTLGLATAPSLSSSQT 1520
Cdd:pfam05109  389 TFEVTVANPVADAKTLIITRTATnATTTTHKVVFHKAPDTTKSVIFVYTLVHVEPHK--------TTAVPTTPSLPPAST 460
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1521 PGHPLLLAPTSSHVPGLNSTVAPAcspVLVPASALASPFPSAPNPAPAqaSLLAPASSASQALATPLAPMAAPQTAILAP 1600
Cdd:pfam05109  461 GPTVSTADPTSGTPTGTTSSTLPE---DTSPTSRTTSATPNATSPTPA--VTTPNATSPTTQKTSDTPNATSPTPIVIGV 535
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1601 SPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT 1680
Cdd:pfam05109  536 TTTATSPPTGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSPTSQQPGIPSSSHSTPRSNSTST 615
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1681 LALAPALAPTlGGSSPSQTlslgtgNPQGPFPTQTLSLTPASslvptPAQTLSLAPGPPLGPTQTLslapapplapaspv 1760
Cdd:pfam05109  616 TPLLTSAHPT-GGENITEE------TPSVPSTTHVSTLSPGP-----GPGTTSQVSGPGNSSTSRY-------------- 669
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1761 gPAPAHTLTLAPASSSASLLAPASVQTltlspaPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSR 1840
Cdd:pfam05109  670 -PGEVHVTEGMPNPNATSPSAPSGQKT------AVPTVTSTGGKANSTTKETSGSTLMASTSPHTNEGAFRTTPYNATTY 742
                          410       420
                   ....*....|....*....|....*
gi 146219843  1841 LPVSKDEpdTLTLRSGPPSPPSTAT 1865
Cdd:pfam05109  743 LPPSTSS--KLRPRWTFTSPPVTTK 765
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1492-1739 1.48e-10

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 65.67  E-value: 1.48e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1492 SLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQAS 1571
Cdd:PRK12323  344 ALAPDEYAGFTMTLLRMLAFRPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAP 423
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1572 llAPASSASQALAtplapmAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSStpgtslASASPVPAP 1651
Cdd:PRK12323  424 --ARRSPAPEALA------AARQASARGPGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAAAAAP------ARAAPAAAP 489
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1652 TPVLAPSSTQTMLPAPVPSPLPSPAstqtlALAPALAPTLGGSSPsqtlslGTGNPQGPFPTQTLSLTPASSLVPTPAQT 1731
Cdd:PRK12323  490 APADDDPPPWEELPPEFASPAPAQP-----DAAPAGWVAESIPDP------ATADPDDAFETLAPAPAAAPAPRAAAATE 558

                  ....*...
gi 146219843 1732 LSLAPGPP 1739
Cdd:PRK12323  559 PVVAPRPP 566
PHA03247 PHA03247
large tegument protein UL36; Provisional
1515-2020 2.44e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 62.26  E-value: 2.44e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1515 LSSSQTPGHPLL---------LAPTSSHVPGLNSTVAPACSPVlvPASALASPFPSAPNPAPAQASLLA-------PASS 1578
Cdd:PHA03247 2469 LLGELFPGAPVYrrpaearfpFAAGAAPDPGGGGPPDPDAPPA--PSRLAPAILPDEPVGEPVHPRMLTwirgleeLASD 2546
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1579 ASQALATPLAPMAAPQTA-----ILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVpvmAPSSTPGTSLASASPVPAPT- 1652
Cdd:PHA03247 2547 DAGDPPPPLPPAAPPAAPdrsvpPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPV---DDRGDPRGPAPPSPLPPDTHa 2623
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1653 ---PVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTlSLGTGNPQGPFPTQTL-SLTPASSLVPTP 1728
Cdd:PHA03247 2624 pdpPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRA-AQASSPPQRPRRRAARpTVGSLTSLADPP 2702
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1729 AQTLSLAPGPPLGPTQTLSLAPAPPLApaspvGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLAL 1808
Cdd:PHA03247 2703 PPPPTPEPAPHALVSATPLPPGPAAAR-----QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAA 2777
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1809 APASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATSFGGPRPRRQPPPPPRSPfylds 1888
Cdd:PHA03247 2778 GPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPL----- 2852
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1889 leekrkrqrserlerifqlseaHGALAPvyGTEVLDFCTLPQPVASPIGPRSPgpshptfwtyteaahravlfPQQRLDQ 1968
Cdd:PHA03247 2853 ----------------------GGSVAP--GGDVRRRPPSRSPAAKPAAPARP--------------------PVRRLAR 2888
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|...
gi 146219843 1969 LSEIIERFIFVMPPVE-APPPSLHACHPPPWLAPRQAAFQEQLASELWPRARP 2020
Cdd:PHA03247 2889 PAVSRSTESFALPPDQpERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQP 2941
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1344-1745 5.79e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 50.75  E-value: 5.79e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1344 PRPTLTPGRLPTPTLGTARAPMPTPTlvrpllklVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPL 1423
Cdd:PRK07764  406 PAAAPAPAAAAPAAAAAPAPAAAPQP--------APAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPT 477
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1424 ASPVSSTVSVPLSsslpisvPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTpplaPVVPAAPGPPSLAPSGASPSAS 1503
Cdd:PRK07764  478 AAPAPAPPAAPAP-------AAAPAAPAAPAAPAGADDAATLRERWPEILAAVP----KRSRKTWAILLPEATVLGVRGD 546
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1504 ALTLGLATAPSLSSSQTPGHPLLLAPTSSHVpgLNSTVAPACspVLVPASAlASPFPSAPNPAPAQASLLAPASSASQAL 1583
Cdd:PRK07764  547 TLVLGFSTGGLARRFASPGNAEVLVTALAEE--LGGDWQVEA--VVGPAPG-AAGGEGPPAPASSGPPEEAARPAAPAAP 621
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1584 ATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPvmAPSSTPGTSLASASPVPAPTPVLAPSSTQTM 1663
Cdd:PRK07764  622 AAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDG--WPAKAGGAAPAAPPPAPAPAAPAAPAGAAPA 699
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1664 LPAP----VPSPLPSPASTQTLALAPAlaptlGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSlVPTPAQTLSLAPGPP 1739
Cdd:PRK07764  700 QPAPapaaTPPAGQADDPAAQPPQAAQ-----GASAPSPAADDPVPLPPEPDDPPDPAGAPAQP-PPPPAPAPAAAPAAA 773

                  ....*.
gi 146219843 1740 LGPTQT 1745
Cdd:PRK07764  774 PPPSPP 779
PTZ00121 PTZ00121
MAEBL; Provisional
2170-2362 1.73e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 49.37  E-value: 1.73e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2170 RTVEEniLKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSSSVPSAPEEEEETVASKQTHILEQALCRAE 2249
Cdd:PTZ00121 1552 KKAEE--LKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAE 1629
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2250 DE-EDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAGRPGAED----EEMSRAEQEIAALVEQLTPIERYAMKFLE--- 2321
Cdd:PTZ00121 1630 EEkKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDkkkaEEAKKAEEDEKKAAEALKKEAEEAKKAEElkk 1709
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 146219843 2322 ASLEEVSR-EELKQAEE----QVEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:PTZ00121 1710 KEAEEKKKaEELKKAEEenkiKAEEAKKEAEEDKKKAEEAKKDEEE 1755
chromosome_segregation_protein_related_ptotein TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2228-2362 3.45e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 45.06  E-value: 3.45e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2228 EEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAEL---------------AEFNENDGFPAGEGEEAGRpgaED 2292
Cdd:TIGR02169  343 REIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETrdelkdyrekleklkREINELKRELDRLQEELQR---LS 419
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2293 EEMSRAEQEIAALVEQLTPieryamkfLEASLEEVsREELKQAEEQVEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:TIGR02169  420 EELADLNAAIAGIEAKINE--------LEEEKEDK-ALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDR 480
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
1259-1504 5.14e-03

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 41.07  E-value: 5.14e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1259 LIQAVAPTPGP-TPVSVLPSSTPSTTPAPTGlslPLAANQVPPTmvnntgVVKIVVRQAPrdgltpvpplaPAPRPPSSG 1337
Cdd:PLN03209  302 VVEVIAETTAPlTPMEELLAKIPSQRVPPKE---SDAADGPKPV------PTKPVTPEAP-----------SPPIEEEPP 361
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1338 LPAVLNPRP--------TLTPGRLPTPTLGTARAPMPTPT-----LVRPLLKLVHSPSPEVSASAPGAAPLTISSPLHVP 1404
Cdd:PLN03209  362 QPKAVVPRPlspytayeDLKPPTSPIPTPPSSSPASSKSVdavakPAEPDVVPSPGSASNVPEVEPAQVEAKKTRPLSPY 441
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1405 SSLPG--PASSPMPIPnSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAP 1482
Cdd:PLN03209  442 ARYEDlkPPTSPSPTA-PTGVSPSVSSTSSVPAVPDTAPATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPAAPVGK 520
                         250       260
                  ....*....|....*....|..
gi 146219843 1483 VVPAAPGPPSLAPSGASPSASA 1504
Cdd:PLN03209  521 VAPSSTNEVVKVGNSAPPTALA 542
 
Name Accession Description Interval E-value
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
2036-2164 1.48e-28

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 114.64  E-value: 1.48e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2036 RLIQYDCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKriFCFI 2115
Cdd:cd00079     5 YVLPVEDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPGIKVAALHGDGSQEEREEVLKDFREGE--IVVL 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 2116 LSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIY 2164
Cdd:cd00079    83 VATDVIARGIDLPNVSVVINYDLPWSPSSYLQRIGRAGRAGQKGTAILL 131
DEXDc cd00046
DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or ...
638-777 5.52e-23

DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 238005  Cd Length: 144  Bit Score: 98.95  E-value: 5.52e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  638 NGILADEMGLGKTIQTISLLAHlACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTYYGAQKERKLKRQGWTKP 715
Cdd:cd00046     2 DVLLAAPTGSGKTLAALLPILE-LLDSLKGGQVLVLAPTRELANQVAERLKELFGEgiKVGYLIGGTSIKQQEKLLSGKT 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 146219843  716 nafHVCITSYKLVLQDHQ--AFRRKNWRYLILDEAQNIKN---FKSQRWQSLLNFNSQRRLLLTGTP 777
Cdd:cd00046    81 ---DIVVGTPGRLLDELErlKLSLKKLDLLILDEAHRLLNqgfGLLGLKILLKLPKDRQVLLLSATP 144
HSA pfam07529
HSA; This domain is predicted to bind DNA and is often found associated with helicases.
125-196 1.74e-24

HSA; This domain is predicted to bind DNA and is often found associated with helicases.


Pssm-ID: 254265  Cd Length: 73  Bit Score: 101.23  E-value: 1.74e-24
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843   125 PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERAR-REEQAKLRRIAS 196
Cdd:pfam07529    1 QRLEEEQREKTHWDHLLEEMLWMSKDFREERKWKIAKAKKLARAVAQYHKYIEKEEQRRKeREAKERLKALKA 73
HELICc smart00490
helicase superfamily c-terminal domain;
2073-2156 1.16e-22

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 96.13  E-value: 1.16e-22
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   2073 DVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRifCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRC 2152
Cdd:smart00490    1 EELAELLKELGIKVARLHGGLSQEEREEILDKFNNGKI--KVLVATDVAERGLDLPGVDLVIIYDLPWSPASYIQRIGRA 78

                    ....
gi 146219843   2153 HRIG 2156
Cdd:smart00490   79 GRAG 82
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
2077-2156 1.03e-21

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 249733  Cd Length: 78  Bit Score: 93.35  E-value: 1.03e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2077 QFLTYHGHLYLRLDGSTRVEQRQALMERFNADKriFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIG 2156
Cdd:pfam00271    1 KLLRKPGIKVARLHGGLSQEEREEILEDFRNGK--SKVLVATDVAGRGIDLPDVNVVINYDLPWNPESYIQRIGRAGRAG 78
HSA smart00573
domain in helicases and associated with SANT domains;
125-196 6.16e-21

domain in helicases and associated with SANT domains;


Pssm-ID: 214727  Cd Length: 73  Bit Score: 90.92  E-value: 6.16e-21
                            10        20        30        40        50        60        70
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843    125 PKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEER-ARREEQAKLRRIAS 196
Cdd:smart00573    1 QKLEEERRRKQHWDHLLEEMIWHAKDFKEEHKWKIAAAKKMAKAVMDYHQNKEKEEERrEEKNEKRRLRKLAA 73
SNF2_N pfam00176
SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of ...
621-907 1.83e-100

SNF2 family N-terminal domain; This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).


Pssm-ID: 249654 [Multi-domain]  Cd Length: 286  Bit Score: 328.09  E-value: 1.83e-100
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   621 YQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSF--KILTY 698
Cdd:pfam00176    1 YQLEGVNWMIRLENNGNGGILADEMGLGKTLQTIALIAYLKEEAPRGGPTLIVVPLSLLDNWLNEFEKWAPPDtlRVLVY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   699 YGAQKERKLKRQGwTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPL 778
Cdd:pfam00176   81 DGTNSYEARKQFQ-NKLRDYDVVITTYEVLRKDKSVLKKIKWDRVVLDEGHRLKNSQSKLYEALNKLRTRNRLILTGTPI 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843   779 QNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTgmiegsQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIR 858
Cdd:pfam00176  160 QNNLAELWSLLNFLRPGPFGSREDFDNWFSRPIA------EELGKEGLNRLHKLLKPFLLRRTKSDVEKSLPPKTEHILF 233
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|...
gi 146219843   859 CRLSKRQRCLYDDFMAQTTTKETLATGH----FMSVINILMQLRKVCNHPNLF 907
Cdd:pfam00176  234 VNLSDEQRKLYNKLLTKSRLAINLVNNEikggKSSILNLIMELRKICNHPYLF 286
DUF3432 pfam11914
Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. ...
1377-1460 4.33e-03

Domain of unknown function (DUF3432); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 100 amino acids in length. This domain is found associated with pfam00096. This domain has two conserved sequence motifs: YPSPV and PSP.


Pssm-ID: 152349 [Multi-domain]  Cd Length: 100  Bit Score: 38.58  E-value: 4.33e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1377 LVHSPSPEVSASAPGA-----APLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPA 1451
Cdd:pfam11914    6 PVSTASPNISIYSSSPvssypSPIATSYPSPVPTSYSSPVSSCYPSPVHTSFPSPSIATTYPSVSPTFQTQVATSFPSSV 85
                           90
                   ....*....|....
gi 146219843  1452 -----SAPLTIPIS 1460
Cdd:pfam11914   86 vtnsfSSPVTTPLS 99
PLN03142 PLN03142
Probable chromatin-remodeling complex ATPase chain; Provisional
611-918 6.39e-92

Probable chromatin-remodeling complex ATPase chain; Provisional


Pssm-ID: 215601 [Multi-domain]  Cd Length: 1033  Bit Score: 326.37  E-value: 6.39e-92
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  611 PLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWC 690
Cdd:PLN03142  163 PSCIKGKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLGYLHEYRGITGPHMVVAPKSTLGNWMNEIRRFC 242
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  691 PSFKILTYYGAQKERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRR 770
Cdd:PLN03142  243 PVLRAVKFHGNPEERAHQREELLVAGKFDVCVTSFEMAIKEKTALKRFSWRYIIIDEAHRIKNENSLLSKTMRLFSTNYR 322
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  771 LLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNpltgmieGSQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMP 850
Cdd:PLN03142  323 LLITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQI-------SGENDQQEVVQQLHKVLRPFLLRRLKSDVEKGLP 395
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146219843  851 KKYEHVIRCRLSKRQRCLYDDFMaQTTTKETLATGHFMSVINILMQLRKVCNHPNLF---DPRPvtsPFIT 918
Cdd:PLN03142  396 PKKETILKVGMSQMQKQYYKALL-QKDLDVVNAGGERKRLLNIAMQLRKCCNHPYLFqgaEPGP---PYTT 462
HepA COG0553
Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, ...
552-949 3.77e-75

Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223627 [Multi-domain]  Cd Length: 866  Bit Score: 271.99  E-value: 3.77e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  552 EYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLVT 631
Cdd:COG0553   273 EDLFARLRLLDPLRLADLSQILEKFVRETLKLSARDLKDELKELLAELRLSEDLLNAPEPVDLSAELRPYQLEGVNWLSE 352
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  632 M-YEKKLNGILADEMGLGKTIQTISLLAHLACE-KGNWGPHLIIVPTSVMLNWEMELKRWCPSFK-ILTYYGAQKERKLK 708
Cdd:COG0553   353 LlRSNLLGGILADDMGLGKTVQTIALLLSLLESiKVYLGPALIVVPASLLSNWKREFEKFAPDLRlVLVYHGEKSELDKK 432
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  709 RQGW------TKPNAFHVCITSYKLV---LQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQ 779
Cdd:COG0553   433 REALrdllklHLVIIFDVVITTYELLrrfLVDHGGLKKIEWDRVVLDEAHRIKNDQSSEGKALQFLKALNRLDLTGTPLE 512
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  780 NSLMELWSLM-HFLMPHVF-QSHREFKEWFSNPLTGMIE-GSQEYNEGLVKRLHKVLRPFLLRRVK--VDVEKQMPKKYE 854
Cdd:COG0553   513 NRLGELWSLLqEFLNPGLLgTSFAIFTRLFEKPIQAEEDiGPLEARELGIELLRKLLSPFILRRTKedVEVLKELPPKIE 592
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  855 HVIRCRLSKRQRCLYDDFM-----AQTTTKETLATG--------HFMSVINILMQLRKVCNHPNLFDPRPVTSPfitPGI 921
Cdd:COG0553   593 KVLECELSEEQRELYEALLegaekNQQLLEDLEKADsdenrigdSELNILALLTRLRQICNHPALVDEGLEATF---DRI 669
                         410       420
                  ....*....|....*....|....*...
gi 146219843  922 CFSTASLVLRATDVHPLQRIDMGRFDLI 949
Cdd:COG0553   670 VLLLREDKDFDYLKKPLIQLSKGKLQAL 697
PLN03142 PLN03142
Probable chromatin-remodeling complex ATPase chain; Provisional
2043-2212 5.71e-50

Probable chromatin-remodeling complex ATPase chain; Provisional


Pssm-ID: 215601 [Multi-domain]  Cd Length: 1033  Bit Score: 194.25  E-value: 5.71e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2043 GKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNAD-KRIFCFILSTRSG 2121
Cdd:PLN03142  471 GKMVLLDKLLPKLKERDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGEDRDASIDAFNKPgSEKFVFLLSTRAG 550
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2122 GVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTtayf 2201
Cdd:PLN03142  551 GLGINLATADIVILYDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTEYTIEEKVIERAYKKLALDALVIQQGRLA---- 626
                         170
                  ....*....|...
gi 146219843 2202 KQQTIR--ELFDM 2212
Cdd:PLN03142  627 EQKTVNkdELLQM 639
HepA COG0553
Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, ...
2037-2212 1.40e-45

Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223627 [Multi-domain]  Cd Length: 866  Bit Score: 179.16  E-value: 1.40e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2037 LIQYDCGKLQTLAVLLR-QLKAEGH--RVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRIFC 2113
Cdd:COG0553   686 LIQLSKGKLQALDELLLdKLLEEGHyhKVLIFSQFTPVLDLLEDYLKALGIKYVRLDGSTPAKRRQELIDRFNADEEEKV 765
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2114 FILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMAIEG 2193
Cdd:COG0553   766 FLLSLKAGGLGLNLTGADTVILFDPWWNPAVELQAIDRAHRIGQKRPVKVYRLITRGTIEEKILELQEKKQELLDSLIDA 845
                         170       180
                  ....*....|....*....|
gi 146219843 2194 GNFTTAY-FKQQTIRELFDM 2212
Cdd:COG0553   846 EGEKELSkLSIEDLLDLFSL 865
DEXDc smart00487
DEAD-like helicases superfamily;
610-790 1.98e-27

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 113.74  E-value: 1.98e-27
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843    610 IPLLLRGQLREYQHIGLDWlvtMYEKKLNGILADEMGLGKTIQ-TISLLAHLAceKGNWGPHLIIVPT-SVMLNWEMELK 687
Cdd:smart00487    1 IEKFGFEPLRPYQKEAIEA---LLSGLRDVILAAPTGSGKTLAaLLPALEALK--RGKGGRVLVLVPTrELAEQWAEELK 75
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843    688 RWCPSF--KILTYYGAQKERKLKRQgWTKpNAFHVCITSYKLVLQD--HQAFRRKNWRYLILDEAQNIKN--FKSQrWQS 761
Cdd:smart00487   76 KLGPSLglKVVGLYGGDSKREQLRK-LES-GKTDILVTTPGRLLDLleNDKLSLSNVDLVILDEAHRLLDggFGDQ-LEK 152
                           170       180       190
                    ....*....|....*....|....*....|.
gi 146219843    762 LLNF--NSQRRLLLTGTPLQNSLMELWSLMH 790
Cdd:smart00487  153 LLKLlpKNVQLLLLSATPPEEIENLLELFLN 183
PHA03247 PHA03247
large tegument protein UL36; Provisional
1366-1834 7.97e-21

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 100.40  E-value: 7.97e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1366 PTPtlvrPLLKLVHSPSPEVSASAPGAAPL----TISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPI 1441
Cdd:PHA03247 2551 PPP----PLPPAAPPAAPDRSVPPPRPAPRpsepAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDP 2626
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1442 SVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATapSLSSSQTP 1521
Cdd:PHA03247 2627 PPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLT--SLADPPPP 2704
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1522 GHPLLLAPTSShVPGLNSTVAPACSPVLVPASALASPFPSAPN----PAPAQASLLAPASSASQALATPLAPMAAPQTAI 1597
Cdd:PHA03247 2705 PPTPEPAPHAL-VSATPLPPGPAAARQASPALPAAPAPPAVPAgpatPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRL 2783
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1598 LAPSPAPPLAPLPVLAPSPGAAPVlassqtPVPVMAPSSTPGTSLASASPVPAPTPvlapsstqtmlPAPVPSPLPSPAS 1677
Cdd:PHA03247 2784 TRPAVASLSESRESLPSPWDPADP------PAAVLAPAAALPPAASPAGPLPPPTS-----------AQPTAPPPPPGPP 2846
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1678 TQTLALAPALAPtlGGSSPSQtlslgtGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAP--GPPLGPTQTLSLAPAPPLA 1755
Cdd:PHA03247 2847 PPSLPLGGSVAP--GGDVRRR------PPSRSPAAKPAAPARPPVRRLARPAVSRSTESfaLPPDQPERPPQPQAPPPPQ 2918
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146219843 1756 PASPVGPAPAHTLTLAPASSSASLLAPasvqTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLP 1834
Cdd:PHA03247 2919 PQPQPPPPPQPQPPPPPPPRPQPPLAP----TTDPAGAGEPSGAVPQPWLGALVPGRVAVPRFRVPQPAPSREAPASST 2993
PHA03247 PHA03247
large tegument protein UL36; Provisional
1339-1866 3.44e-19

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 95.01  E-value: 3.44e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1339 PAVLNPRPTLTPGRLPTPTLGTARAPMpTPTLVRPLLKLVHS----PSPEVSASAPGAAPltissplhvPSSLPGPASSP 1414
Cdd:PHA03247 2506 PDAPPAPSRLAPAILPDEPVGEPVHPR-MLTWIRGLEELASDdagdPPPPLPPAAPPAAP---------DRSVPPPRPAP 2575
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1415 MPIP------NSSPLASPVSSTVSVPL--SSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPA 1486
Cdd:PHA03247 2576 RPSEpavtsrARRPDAPPQSARPRAPVddRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDD 2655
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1487 ApgppslAPSGASPSASALTLGLATAPSlsssqtpghplllAPTSSHVPglnstvaPACSPVLVPASALASPFPSAPNPA 1566
Cdd:PHA03247 2656 P------APGRVSRPRRARRLGRAAQAS-------------SPPQRPRR-------RAARPTVGSLTSLADPPPPPPTPE 2709
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1567 PaqasllaPASSASQALATPLAPMAAPQTAilapspapPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASAS 1646
Cdd:PHA03247 2710 P-------APHALVSATPLPPGPAAARQAS--------PALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAA 2774
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1647 PVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLslgtgnPQGPFPTQTLSLTPASSLVP 1726
Cdd:PHA03247 2775 PAAGPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPL------PPPTSAQPTAPPPPPGPPPP 2848
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1727 TPAQTLSLAPGPPL---GPTQTLSLAPAPPLAPASPVGPAPAHT----------LTLAPASSSASLLAPASVQTLTLSPA 1793
Cdd:PHA03247 2849 SLPLGGSVAPGGDVrrrPPSRSPAAKPAAPARPPVRRLARPAVSrstesfalppDQPERPPQPQAPPPPQPQPQPPPPPQ 2928
                         490       500       510       520       530       540       550
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 146219843 1794 PVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTM-VSRLPVSKDEPDTLTLRSGPPSPPSTATS 1866
Cdd:PHA03247 2929 PQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVaVPRFRVPQPAPSREAPASSTPPLTGHSLS 3002
PHA03247 PHA03247
large tegument protein UL36; Provisional
1227-1738 4.40e-14

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 78.06  E-value: 4.40e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1227 AVGQPRPLQRNVVHLVSAggQHHLISQPAHVALIQAVAPTPGPTPVSVLPSSTPsttPAPTGLSLPLAANQVPPTMVNNT 1306
Cdd:PHA03247 2567 SVPPPRPAPRPSEPAVTS--RARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLP---PDTHAPDPPPPSPSPAANEPDPH 2641
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1307 GVVKIVVRQAPRDgltpvpplapaprppSSGLPAVLNPRPTLTPGRLPTPTLGTAR-APMPTPTLVRPLLKLVHSPSPEv 1385
Cdd:PHA03247 2642 PPPTVPPPERPRD---------------DPAPGRVSRPRRARRLGRAAQASSPPQRpRRRAARPTVGSLTSLADPPPPP- 2705
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1386 saSAPGAAPLTISSPLHVPSSlPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPltv 1465
Cdd:PHA03247 2706 --PTPEPAPHALVSATPLPPG-PAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGP--- 2779
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1466 sasGPALltsvTPPLAPVVPAAPGPPSLAPSGASPSASALtlglATAPSLSSSQTPGHPLllAPTSSHVPGLNSTVAPAC 1545
Cdd:PHA03247 2780 ---PRRL----TRPAVASLSESRESLPSPWDPADPPAAVL----APAAALPPAASPAGPL--PPPTSAQPTAPPPPPGPP 2846
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1546 SPVLVPASALASPFPSAPNPAPAQASllapassasqalATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASS 1625
Cdd:PHA03247 2847 PPSLPLGGSVAPGGDVRRRPPSRSPA------------AKPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAP 2914
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1626 QTPVPVMAPSSTPGTSLASASPvPAPTPVLAPSSTqtmlPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLSLGTG 1705
Cdd:PHA03247 2915 PPPQPQPQPPPPPQPQPPPPPP-PRPQPPLAPTTD----PAGAGEPSGAVPQPWLGALVPGRVAVPRFRVPQPAPSREAP 2989
                         490       500       510
                  ....*....|....*....|....*....|...
gi 146219843 1706 NPQGPFPTQtLSLTPASSLVPTPAQTLSLAPGP 1738
Cdd:PHA03247 2990 ASSTPPLTG-HSLSRVSSWASSLALHEETDPPP 3021
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
1442-1865 3.58e-12

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 70.96  E-value: 3.58e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1442 SVPTTLPAPASAPLTIPISAPLT-VSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGaspsasalTLGLATAPSLSSSQT 1520
Cdd:pfam05109  389 TFEVTVANPVADAKTLIITRTATnATTTTHKVVFHKAPDTTKSVIFVYTLVHVEPHK--------TTAVPTTPSLPPAST 460
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1521 PGHPLLLAPTSSHVPGLNSTVAPAcspVLVPASALASPFPSAPNPAPAqaSLLAPASSASQALATPLAPMAAPQTAILAP 1600
Cdd:pfam05109  461 GPTVSTADPTSGTPTGTTSSTLPE---DTSPTSRTTSATPNATSPTPA--VTTPNATSPTTQKTSDTPNATSPTPIVIGV 535
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1601 SPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT 1680
Cdd:pfam05109  536 TTTATSPPTGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSPTSQQPGIPSSSHSTPRSNSTST 615
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1681 LALAPALAPTlGGSSPSQTlslgtgNPQGPFPTQTLSLTPASslvptPAQTLSLAPGPPLGPTQTLslapapplapaspv 1760
Cdd:pfam05109  616 TPLLTSAHPT-GGENITEE------TPSVPSTTHVSTLSPGP-----GPGTTSQVSGPGNSSTSRY-------------- 669
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1761 gPAPAHTLTLAPASSSASLLAPASVQTltlspaPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSR 1840
Cdd:pfam05109  670 -PGEVHVTEGMPNPNATSPSAPSGQKT------AVPTVTSTGGKANSTTKETSGSTLMASTSPHTNEGAFRTTPYNATTY 742
                          410       420
                   ....*....|....*....|....*
gi 146219843  1841 LPVSKDEpdTLTLRSGPPSPPSTAT 1865
Cdd:pfam05109  743 LPPSTSS--KLRPRWTFTSPPVTTK 765
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1492-1739 1.48e-10

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 65.67  E-value: 1.48e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1492 SLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQAS 1571
Cdd:PRK12323  344 ALAPDEYAGFTMTLLRMLAFRPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAP 423
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1572 llAPASSASQALAtplapmAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSStpgtslASASPVPAP 1651
Cdd:PRK12323  424 --ARRSPAPEALA------AARQASARGPGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAAAAAP------ARAAPAAAP 489
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1652 TPVLAPSSTQTMLPAPVPSPLPSPAstqtlALAPALAPTLGGSSPsqtlslGTGNPQGPFPTQTLSLTPASSLVPTPAQT 1731
Cdd:PRK12323  490 APADDDPPPWEELPPEFASPAPAQP-----DAAPAGWVAESIPDP------ATADPDDAFETLAPAPAAAPAPRAAAATE 558

                  ....*...
gi 146219843 1732 LSLAPGPP 1739
Cdd:PRK12323  559 PVVAPRPP 566
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
1381-1739 1.23e-09

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 62.78  E-value: 1.23e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1381 PSPEVSAS-APGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPvsstvSVPLSSSlPISVPTTLPAPASAPLTiPI 1459
Cdd:pfam03154  155 PSPQDNESdSDSSAQQQLLQPQGPPSIQVPPGAALAPSAPPPTPSAQ-----AVPPQGS-PIAAQPAPQPQQPSPLS-LI 227
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1460 SAPltvsASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGlataPSLSSSQTPGHPLLLAPTSSHVPglns 1539
Cdd:pfam03154  228 SAP----SLHPQRLPSPHPPLQPQTASQQSPQPPAPSSRHPQSSHHGPG----PPMPHALQQGPVFLQHPSSNPPQ---- 295
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1540 tvapacspvlvPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAA 1619
Cdd:pfam03154  296 -----------PFGLAQSQVPPLPLPSQAQPHSHTPPSQSALQPQQPPREQPLPPAPSMPHIKPPPTTPIPQLPNQSHKH 364
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1620 PVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPlPSPASTQTLALAPALAPTLGGSSPSqt 1699
Cdd:pfam03154  365 PPHLQGPSPFPQMPSNLPPPPALKPLSSLPTHHPPSAHPPPLQLMPQSQPLQ-SVPAQPPVLTQSQSLPPKASTHPHS-- 441
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|
gi 146219843  1700 lSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPP 1739
Cdd:pfam03154  442 -GLHSGPPQSPFAQHPFTSGGLPAIGPPPSLPTSTPAAPP 480
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1335-1744 2.14e-09

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 62.11  E-value: 2.14e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1335 SSGLPAVLNPRPTLTPGRLPTPTLGTARAPM-PTPTLVRPLLklvhSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASS 1413
Cdd:PHA03307   74 GPGTEAPANESRSTPTWSLSTLAPASPAREGsPTPPGPSSPD----PPPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPA 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1414 PMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSL 1493
Cdd:PHA03307  150 ASPPAAGASPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAA 229
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1494 APSGASPSASAltlglatapSLSSSQTPGHPLLLAPTSSHVPGlnstVAPACSPVLVPASALASPFPSAPNPAPAQASLL 1573
Cdd:PHA03307  230 DDAGASSSDSS---------SSESSGCGWGPENECPLPRPAPI----TLPTRIWEASGWNGPSSRPGPASSSSSPRERSP 296
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1574 APASSASQALATPLAPMAAPqtailapspapplaplpvLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTP 1653
Cdd:PHA03307  297 SPSPSSPGSGPAPSSPRASS------------------SSSSSRESSSSSTSSSSESSRGAAVSPGPSPSRSPSPSRPPP 358
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1654 VLAPSSTQTmlPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQtlslgtgnpQGPFPTqTLSLTPASSLVPTPAQTLS 1733
Cdd:PHA03307  359 PADPSSPRK--RPRPSRAPSSPAASAGRPTRRRARAAVAGRARRR---------DATGRF-PAGRPRPSPLDAGAASGAF 426
                         410
                  ....*....|.
gi 146219843 1734 LAPGPPLGPTQ 1744
Cdd:PHA03307  427 YARYPLLTPSG 437
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
1492-1863 2.28e-09

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 62.01  E-value: 2.28e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1492 SLAPSGASPSASALTLGLATAPSlSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALA-SPFPSAPNPAPAQA 1570
Cdd:pfam03154  188 ALAPSAPPPTPSAQAVPPQGSPI-AAQPAPQPQQPSPLSLISAPSLHPQRLPSPHPPLQPQTASQqSPQPPAPSSRHPQS 266
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1571 SLLAPASSASQALATplAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPV-- 1648
Cdd:pfam03154  267 SHHGPGPPMPHALQQ--GPVFLQHPSSNPPQPFGLAQSQVPPLPLPSQAQPHSHTPPSQSALQPQQPPREQPLPPAPSmp 344
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1649 ----PAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLggsspsqtlSLGTGNPQGPFPtqtlsltPASSL 1724
Cdd:pfam03154  345 hikpPPTTPIPQLPNQSHKHPPHLQGPSPFPQMPSNLPPPPALKPLS---------SLPTHHPPSAHP-------PPLQL 408
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1725 VPTPaQTLSLAPGPPLGPTQTLSLApapplapaspvGPAPAHTLTLAPASSSASLLAPASVQTLTLSPA-PVPTLGPAAA 1803
Cdd:pfam03154  409 MPQS-QPLQSVPAQPPVLTQSQSLP-----------PKASTHPHSGLHSGPPQSPFAQHPFTSGGLPAIgPPPSLPTSTP 476
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146219843  1804 QTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSK-DEPDTLTLRSGPPSPPST 1863
Cdd:pfam03154  477 AAPPRASSGSQPPGSALPSSGGCAGPGPPLPPIQIKEEPLDEaEEPESPPPPPRSPSPEPT 537
PHA03247 PHA03247
large tegument protein UL36; Provisional
1515-2020 2.44e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 62.26  E-value: 2.44e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1515 LSSSQTPGHPLL---------LAPTSSHVPGLNSTVAPACSPVlvPASALASPFPSAPNPAPAQASLLA-------PASS 1578
Cdd:PHA03247 2469 LLGELFPGAPVYrrpaearfpFAAGAAPDPGGGGPPDPDAPPA--PSRLAPAILPDEPVGEPVHPRMLTwirgleeLASD 2546
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1579 ASQALATPLAPMAAPQTA-----ILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVpvmAPSSTPGTSLASASPVPAPT- 1652
Cdd:PHA03247 2547 DAGDPPPPLPPAAPPAAPdrsvpPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPV---DDRGDPRGPAPPSPLPPDTHa 2623
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1653 ---PVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTlSLGTGNPQGPFPTQTL-SLTPASSLVPTP 1728
Cdd:PHA03247 2624 pdpPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRA-AQASSPPQRPRRRAARpTVGSLTSLADPP 2702
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1729 AQTLSLAPGPPLGPTQTLSLAPAPPLApaspvGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLAL 1808
Cdd:PHA03247 2703 PPPPTPEPAPHALVSATPLPPGPAAAR-----QASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAA 2777
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1809 APASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATSFGGPRPRRQPPPPPRSPfylds 1888
Cdd:PHA03247 2778 GPPRRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPL----- 2852
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1889 leekrkrqrserlerifqlseaHGALAPvyGTEVLDFCTLPQPVASPIGPRSPgpshptfwtyteaahravlfPQQRLDQ 1968
Cdd:PHA03247 2853 ----------------------GGSVAP--GGDVRRRPPSRSPAAKPAAPARP--------------------PVRRLAR 2888
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|...
gi 146219843 1969 LSEIIERFIFVMPPVE-APPPSLHACHPPPWLAPRQAAFQEQLASELWPRARP 2020
Cdd:PHA03247 2889 PAVSRSTESFALPPDQpERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQP 2941
PHA03247 PHA03247
large tegument protein UL36; Provisional
1031-1592 8.59e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 60.34  E-value: 8.59e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1031 ELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSGSLPQVLPSPLGVLSGTSRPPTPTLSLKPTP 1110
Cdd:PHA03247 2542 ELASDDAGDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDT 2621
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1111 PAPvrlspaPPPGSSSLLKPLTVPPGYTFPPAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQL 1190
Cdd:PHA03247 2622 HAP------DPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSL 2695
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1191 ASLAQRPVANAGGSKPLTFQIQGNKLTLTGAQVRQLAVGQP-RPLQRNVVHLVSAGGQhhlisqPAHVALIQAVAPTPGP 1269
Cdd:PHA03247 2696 TSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPaAPAPPAVPAGPATPGG------PARPARPPTTAGPPAP 2769
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1270 TPVSVLPSSTPSTTPAPTGLSLPLAANQVPptmvnntgvvkivvrqAPRDGLTPVPP-LAPAPRPPSSGLPAVLNPRPT- 1347
Cdd:PHA03247 2770 APPAAPAAGPPRRLTRPAVASLSESRESLP----------------SPWDPADPPAAvLAPAAALPPAASPAGPLPPPTs 2833
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1348 -------LTPGRLPTPTL--------------GTARAPMPTPTLVRpllklvHSPSPEVSASAPGAAPLTISSPLHVPSS 1406
Cdd:PHA03247 2834 aqptappPPPGPPPPSLPlggsvapggdvrrrPPSRSPAAKPAAPA------RPPVRRLARPAVSRSTESFALPPDQPER 2907
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1407 LPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPA-----LLTSVTPPLA 1481
Cdd:PHA03247 2908 PPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTTDPAGAGEPSGAVPQPWLGALVPGRVavprfRVPQPAPSRE 2987
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1482 PVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPlllaptSSHVPGLNSTVAPACSPVLVPASAL------ 1555
Cdd:PHA03247 2988 APASSTPPLTGHSLSRVSSWASSLALHEETDPPPVSLKQTLWP------PDDTEDSDADSLFDSDSERSDLEALdplppe 3061
                         570       580       590
                  ....*....|....*....|....*....|....*...
gi 146219843 1556 -ASPFPSAPNPAPAQASllAPASSASQALATPLAPMAA 1592
Cdd:PHA03247 3062 pHDPFAHEPDPATPEAG--ARESPSSQFGPPPLSANAA 3097
SSL2 COG1061
DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and ...
591-777 1.31e-07

DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 55.52  E-value: 1.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  591 AESLQPKG-YTLATTQVKTPIPLLLR----GQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIqtisLLAHLACEKG 665
Cdd:COG1061     5 KQYLSSKGaEELADYVLDEGLPLKLIvafeFELRPYQEEALDALVKNRRTERRGVIVLPTGAGKTV----VAAEAIAELK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  666 NwgPHLIIVPTSVMLN-WEMELKRWC-PSFKILTYYGAQKErklkrqgwtkPNAFHVCITSYK-LVLQDHQAFRRKN-WR 741
Cdd:COG1061    81 R--STLVLVPTKELLDqWAEALKKFLlLNDEIGIYGGGEKE----------LEPAKVTVATVQtLARRQLLDEFLGNeFG 148
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 146219843  742 YLILDEAQNIKNFKSQRWQSLLNfNSQRRLLLTGTP 777
Cdd:COG1061   149 LIIFDEVHHLPAPSYRRILELLS-AAYPRLGLTATP 183
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1643-1843 1.99e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 55.65  E-value: 1.99e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1643 ASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPAS 1722
Cdd:PRK12323  377 AAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAPAA 456
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1723 SLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLS---------PA 1793
Cdd:PRK12323  457 APAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESipdpatadpDD 536
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 146219843 1794 PVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPV----TMVSRLPV 1843
Cdd:PRK12323  537 AFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFDgdwpALAARLPV 590
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
1354-1695 2.24e-07

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 55.55  E-value: 2.24e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1354 PTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAPlTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSV 1433
Cdd:pfam05109  443 PHKTTAVPTTPSLPPASTGPTVSTADPTSGTPTGTTSSTLP-EDTSPTSRTTSATPNATSPTPAVTTPNATSPTTQKTSD 521
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1434 PLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASgpalLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTlglatap 1513
Cdd:pfam05109  522 TPNATSPTPIVIGVTTTATSPPTGTTSVPNATSPQ----VTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTG------- 590
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1514 SLSSSQTPGHPLLLAPTsshvPGLNSTV--APACSPVLVPASALASPFPSAPN--------PAP-----AQASLLAPASS 1578
Cdd:pfam05109  591 SSPTSQQPGIPSSSHST----PRSNSTSttPLLTSAHPTGGENITEETPSVPStthvstlsPGPgpgttSQVSGPGNSST 666
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1579 ASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPS 1658
Cdd:pfam05109  667 SRYPGEVHVTEGMPNPNATSPSAPSGQKTAVPTVTSTGGKANSTTKETSGSTLMASTSPHTNEGAFRTTPYNATTYLPPS 746
                          330       340       350
                   ....*....|....*....|....*....|....*..
gi 146219843  1659 STQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSS 1695
Cdd:pfam05109  747 TSSKLRPRWTFTSPPVTTKQATVPVPPTQHPDHSNLS 783
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1550-1865 2.57e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 55.38  E-value: 2.57e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1550 VPASALASPFPSAPNPAPAQASLLAPASSASQALATplAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPV 1629
Cdd:PRK07764  398 APSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAP--APAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPE 475
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1630 PVMAPSSTPGTSLASASPVPAPTPVLAPSSTQT-------------------------MLPAPVPSPL---------PSP 1675
Cdd:PRK07764  476 PTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDaatlrerwpeilaavpkrsrktwaiLLPEATVLGVrgdtlvlgfSTG 555
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1676 ASTQTLA-------LAPALAPTLG---------GSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPP 1739
Cdd:PRK07764  556 GLARRFAspgnaevLVTALAEELGgdwqveavvGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAA 635
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1740 LGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPA-------- 1811
Cdd:PRK07764  636 PAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAAtppagqad 715
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843 1812 ----STQSPASQASSLVVSASGAAPLP-----VTMVSRLPVSKDEPDTLTLRSGPPSPPSTAT 1865
Cdd:PRK07764  716 dpaaQPPQAAQGASAPSPAADDPVPLPpepddPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSP 778
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1510-1864 2.64e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 55.38  E-value: 2.64e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1510 ATAPSL------------SSSQTPG--HPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASllAP 1575
Cdd:PRK07764  348 ATSPRLllellcarmllpSASDDERglLARLERLERRLGVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAP--AP 425
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1576 ASSASQAlatpLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVL 1655
Cdd:PRK07764  426 AAAPQPA----PAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPA 501
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1656 APSSTQT-------------------------MLPAPVPSPL---------PSPASTQTLA-------LAPALAPTLG-- 1692
Cdd:PRK07764  502 APAGADDaatlrerwpeilaavpkrsrktwaiLLPEATVLGVrgdtlvlgfSTGGLARRFAspgnaevLVTALAEELGgd 581
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1693 -------GSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPA 1765
Cdd:PRK07764  582 wqveavvGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPD 661
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1766 HTLTLAPASSSASLLAPASVQTLTLSPAPVPTLG-----PAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSR 1840
Cdd:PRK07764  662 ASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGaapaqPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPL 741
                         410       420
                  ....*....|....*....|....
gi 146219843 1841 LPVSKDEPDTLTLRSGPPSPPSTA 1864
Cdd:PRK07764  742 PPEPDDPPDPAGAPAQPPPPPAPA 765
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1261-1658 3.07e-07

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 55.18  E-value: 3.07e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1261 QAVAPTPGPTPVSVLPSSTPSTTP------APTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDGLTPVPPLAPAPRPP 1334
Cdd:PHA03307   22 PRPPATPGDAADDLLSGSQGQLVSdsaelaAVTVVAGAAACDRFEPPTGPPPGPGTEAPANESRSTPTWSLSTLAPASPA 101
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1335 SSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLV----HSPSPEVSASAPGAAPLTISSPLHVPSSLPGP 1410
Cdd:PHA03307  102 REGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGpppaASPPAAGASPAAVASDAASSRQAALPLSSPEE 181
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1411 ASSPMPipnsSPLASPVSSTVSVPLSS-----SLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVP 1485
Cdd:PHA03307  182 TARAPS----SPPAEPPPSTPPAAASPrpprrSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPL 257
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1486 AAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPlLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNP 1565
Cdd:PHA03307  258 PRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSP-SPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESS 336
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1566 APAQASLLA-PASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQT------PVPVMAPSSTP 1638
Cdd:PHA03307  337 RGAAVSPGPsPSRSPSPSRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARrrdatgRFPAGRPRPSP 416
                         410       420
                  ....*....|....*....|
gi 146219843 1639 GTSLASASPVPAPTPVLAPS 1658
Cdd:PHA03307  417 LDAGAASGAFYARYPLLTPS 436
PHA03378 PHA03378
EBNA-3B; Provisional
1336-1728 5.14e-07

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 54.30  E-value: 5.14e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1336 SGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLK--LVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASS 1413
Cdd:PHA03378  447 SQAPTVVLHRPPTQPLEGPTGPLSVQAPLEPWQPLPHPQVTpvILHQPPAQGVQAHGSMLDLLEKDDEDMEQRVMATLLP 526
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1414 PMPIPNSSPLASPVSSTVSVPLSSSLPISVPTT----LPAPASAPLTI-PISAPLT--VSASGPALLTSVTP-PLAPVVP 1485
Cdd:PHA03378  527 PSPPQPRAGRRAPCVYTEDLDIESDEPASTEPVhdqlLPAPGLGPLQIqPLTSPTTsqLASSAPSYAQTPWPvPHPSQTP 606
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1486 AAPGPPSLAPSGASPSASALTLglatapslssSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNP 1565
Cdd:PHA03378  607 EPPTTQSHIPETSAPRQWPMPL----------RPIPMRPLRMQPITFNVLVFPTPHQPPQVEITPYKPTWTQIGHIPYQP 676
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1566 APAQASLLAPASSASQALATPLA---PMAAPQTA-ILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPV------------ 1629
Cdd:PHA03378  677 SPTGANTMLPIQWAPGTMQPPPRaptPMRPPAAPpGRAQRPAAATGRARPPAAAPGRARPPAAAPGRArppaaapgrarp 756
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1630 PVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPS--PASTQTLALAPALAPTLGGSSPSQTLSLGT--G 1705
Cdd:PHA03378  757 PAAAPGRARPPAAAPGAPTPQPPPQAPPAPQQRPRGAPTPQPPPQagPTSMQLMPRAAPGQQGPTKQILRQLLTGGVkrG 836
                         410       420
                  ....*....|....*....|...
gi 146219843 1706 NPQGPFPTQTLSLTPAsslVPTP 1728
Cdd:PHA03378  837 RPSLKKPAALERQAAA---GPTP 856
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1556-1836 7.21e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 53.73  E-value: 7.21e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1556 ASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPS 1635
Cdd:PRK12323  372 AGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1636 STPgtslaSASPVPAPTPVLAPsstqtmlPAPVPSPLPSPASTQTLALAPALAPtlggsspsqtlslgtgnpQGPFPTQT 1715
Cdd:PRK12323  452 PAP-----AAAPAAAARPAAAG-------PRPVAAAAAAAPARAAPAAAPAPAD------------------DDPPPWEE 501
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1716 LsltPASSLVPTPAQTlslapgpplgptqtlslapapplapaspvGPAPAhtlTLAPASSSASLLAPASVQTLTLSPAPV 1795
Cdd:PRK12323  502 L---PPEFASPAPAQP-----------------------------DAAPA---GWVAESIPDPATADPDDAFETLAPAPA 546
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 146219843 1796 PTLGPAAAQTLALAPASTQSPASQASSLVVSASG----AAPLPVT 1836
Cdd:PRK12323  547 AAPAPRAAAATEPVVAPRPPRASASGLPDMFDGDwpalAARLPVR 591
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1468-1691 8.92e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 53.34  E-value: 8.92e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1468 SGPAllTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPlllaptsshVPGLNSTVAPACSP 1547
Cdd:PRK12323  372 AGPA--TAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARR---------SPAPEALAAARQAS 440
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1548 VLVPASALASPFPSAPNPAPAQASllAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQT 1627
Cdd:PRK12323  441 ARGPGGAPAPAPAPAAAPAAAARP--AAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAP 518
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1628 PVPVMAPSSTPGTSLASAS-PVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALA-----PALAPTL 1691
Cdd:PRK12323  519 AGWVAESIPDPATADPDDAfETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMfdgdwPALAARL 588
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
1448-1689 9.23e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 53.31  E-value: 9.23e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1448 PAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVvpAAPGPPSLAPSGASPSASAltlgLATAPSLSSSQtpghplll 1527
Cdd:PRK07003  367 APGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAV--TGAAGAALAPKAAAAAAAT----RAEAPPAAPAP-------- 432
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1528 APTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLA 1607
Cdd:PRK07003  433 PATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARA 512
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1608 PLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTS-----------------------LASASPVPAPTPVLAPSSTQTML 1664
Cdd:PRK07003  513 PAAASREDAPAAAAPPAPEARPPTPAAAAPAARAggaaaaldvlrnagmrvssdrgaRAAAAAKPAAAPAAAPKPAAPRV 592
                         250       260
                  ....*....|....*....|....*
gi 146219843 1665 PAPVPSPLPSPASTQTLALAPALAP 1689
Cdd:PRK07003  593 AVQVPTPRARAATGDAPPNGAARAE 617
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1379-1862 1.26e-06

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 53.25  E-value: 1.26e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1379 HSPSPEVSASAPGAAPLTISSPLHVPSSLPGPAsspmPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIP 1458
Cdd:PHA03307   20 FFPRPPATPGDAADDLLSGSQGQLVSDSAELAA----VTVVAGAAACDRFEPPTGPPPGPGTEAPANESRSTPTWSLSTL 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1459 ISAPLTVSASGPALLTSVTPPlapvvpaapgppslAPSGASPSASALTLGLATAPSLSSSQTPGHPlllAPTSSHVPGLN 1538
Cdd:PHA03307   96 APASPAREGSPTPPGPSSPDP--------------PPPTPPPASPPPSPAPDLSEMLRPVGSPGPP---PAASPPAAGAS 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1539 STVAPACSPvlvPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGA 1618
Cdd:PHA03307  159 PAAVASDAA---SSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGAS 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1619 APVLASSQtpvpvmapSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPAStqtlalaPALAPTLGGSSPSQ 1698
Cdd:PHA03307  236 SSDSSSSE--------SSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPAS-------SSSSPRERSPSPSP 300
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1699 TLSLGTGNPQGPFPTQTLSLTPASSLvptpAQTLSLAPGPplgptqtlslapapplaPASPVGPAPAHTLTLAPASSSAS 1778
Cdd:PHA03307  301 SSPGSGPAPSSPRASSSSSSSRESSS----SSTSSSSESS-----------------RGAAVSPGPSPSRSPSPSRPPPP 359
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1779 LLAPASVQTLTLSPAPVPTLGPAAAQTLALApastqspASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPP 1858
Cdd:PHA03307  360 ADPSSPRKRPRPSRAPSSPAASAGRPTRRRA-------RAAVAGRARRRDATGRFPAGRPRPSPLDAGAASGAFYARYPL 432

                  ....
gi 146219843 1859 SPPS 1862
Cdd:PHA03307  433 LTPS 436
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
1557-1867 1.62e-06

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 52.77  E-value: 1.62e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1557 SPFPSAPNPAPAQASllaPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPvlASSQTPVPVMAPSS 1636
Cdd:pfam03154  149 SSSPSIPSPQDNESD---SDSSAQQQLLQPQGPPSIQVPPGAALAPSAPPPTPSAQAVPPQGSP--IAAQPAPQPQQPSP 223
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1637 TPGTSLASASP--VPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQ 1714
Cdd:pfam03154  224 LSLISAPSLHPqrLPSPHPPLQPQTASQQSPQPPAPSSRHPQSSHHGPGPPMPHALQQGPVFLQHPSSNPPQPFGLAQSQ 303
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1715 tlsltpaSSLVPTPAQTLSLAPGPP----LGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSS---ASLLAPASVQT 1787
Cdd:pfam03154  304 -------VPPLPLPSQAQPHSHTPPsqsaLQPQQPPREQPLPPAPSMPHIKPPPTTPIPQLPNQSHkhpPHLQGPSPFPQ 376
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1788 LTLSPAPVPTLGPAAAQTLALAPASTQSPAS-QASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATS 1866
Cdd:pfam03154  377 MPSNLPPPPALKPLSSLPTHHPPSAHPPPLQlMPQSQPLQSVPAQPPVLTQSQSLPPKASTHPHSGLHSGPPQSPFAQHP 456

                   .
gi 146219843  1867 F 1867
Cdd:pfam03154  457 F 457
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
1558-1681 1.63e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 52.41  E-value: 1.63e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1558 PFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSST 1637
Cdd:PRK14951  366 PAAAAEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAV 445
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 146219843 1638 PGTSlaSASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTL 1681
Cdd:PRK14951  446 ALAP--APPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAAR 487
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1344-1745 5.79e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 50.75  E-value: 5.79e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1344 PRPTLTPGRLPTPTLGTARAPMPTPTlvrpllklVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPL 1423
Cdd:PRK07764  406 PAAAPAPAAAAPAAAAAPAPAAAPQP--------APAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAPAPAAAPEPT 477
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1424 ASPVSSTVSVPLSsslpisvPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTpplaPVVPAAPGPPSLAPSGASPSAS 1503
Cdd:PRK07764  478 AAPAPAPPAAPAP-------AAAPAAPAAPAAPAGADDAATLRERWPEILAAVP----KRSRKTWAILLPEATVLGVRGD 546
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1504 ALTLGLATAPSLSSSQTPGHPLLLAPTSSHVpgLNSTVAPACspVLVPASAlASPFPSAPNPAPAQASLLAPASSASQAL 1583
Cdd:PRK07764  547 TLVLGFSTGGLARRFASPGNAEVLVTALAEE--LGGDWQVEA--VVGPAPG-AAGGEGPPAPASSGPPEEAARPAAPAAP 621
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1584 ATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPvmAPSSTPGTSLASASPVPAPTPVLAPSSTQTM 1663
Cdd:PRK07764  622 AAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDG--WPAKAGGAAPAAPPPAPAPAAPAAPAGAAPA 699
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1664 LPAP----VPSPLPSPASTQTLALAPAlaptlGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSlVPTPAQTLSLAPGPP 1739
Cdd:PRK07764  700 QPAPapaaTPPAGQADDPAAQPPQAAQ-----GASAPSPAADDPVPLPPEPDDPPDPAGAPAQP-PPPPAPAPAAAPAAA 773

                  ....*.
gi 146219843 1740 LGPTQT 1745
Cdd:PRK07764  774 PPPSPP 779
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
1316-1712 5.86e-06

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 50.84  E-value: 5.86e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1316 APRDGLTPVPPLAPAPRPPSSGLPAV-LNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKlVHSPSPEVSASAPGAAp 1394
Cdd:pfam03154  156 SPQDNESDSDSSAQQQLLQPQGPPSIqVPPGAALAPSAPPPTPSAQAVPPQGSPIAAQPAPQ-PQQPSPLSLISAPSLH- 233
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1395 ltissplhvPSSLPGPASSPMPIPNSSPLASPVSSTVSVPlSSSLPISVPTTLPAPASAPLTIPisapltvsasgpallt 1474
Cdd:pfam03154  234 ---------PQRLPSPHPPLQPQTASQQSPQPPAPSSRHP-QSSHHGPGPPMPHALQQGPVFLQ---------------- 287
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1475 svtPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATA-PSLSSSQTP-GHPLLLAPTSSHV---PGLNSTVAPACSPVL 1549
Cdd:pfam03154  288 ---HPSSNPPQPFGLAQSQVPPLPLPSQAQPHSHTPPSqSALQPQQPPrEQPLPPAPSMPHIkppPTTPIPQLPNQSHKH 364
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1550 VPASALASPFPSAPNPAPAQASLLAPASSASQ----ALATPLAPMAAPQTAilapspapplaplpvlAPSPGAAPVLASS 1625
Cdd:pfam03154  365 PPHLQGPSPFPQMPSNLPPPPALKPLSSLPTHhppsAHPPPLQLMPQSQPL----------------QSVPAQPPVLTQS 428
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1626 QTPVPvmAPSSTPGTSLASASPVPAptpvlAPSSTQTMLPAPVPSPLPSPaSTQTLALAPALAPTLGGSSPSQTLSLGTG 1705
Cdd:pfam03154  429 QSLPP--KASTHPHSGLHSGPPQSP-----FAQHPFTSGGLPAIGPPPSL-PTSTPAAPPRASSGSQPPGSALPSSGGCA 500

                   ....*..
gi 146219843  1706 NPQGPFP 1712
Cdd:pfam03154  501 GPGPPLP 507
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1345-1580 9.84e-06

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 49.87  E-value: 9.84e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1345 RPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAPLTISSPLHVPSSLPgPASSPMPIPNSSPLA 1424
Cdd:PRK12323  364 RPGQSGGGAGPATAAAAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRS-PAPEALAAARQASAR 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1425 SPVSstVSVPLSSSLPISVPTTLPAPASA---PLTIPISAPLTVSASGPALLTSVTPPLapvvpaapgpPSLAPSGASPS 1501
Cdd:PRK12323  443 GPGG--APAPAPAPAAAPAAAARPAAAGPrpvAAAAAAAPARAAPAAAPAPADDDPPPW----------EELPPEFASPA 510
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146219843 1502 ASALTLGLATAPSLSSSQtpghplllaPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSAS 1580
Cdd:PRK12323  511 PAQPDAAPAGWVAESIPD---------PATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFDGD 580
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
1560-1698 1.10e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 49.86  E-value: 1.10e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1560 PSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPG 1639
Cdd:PRK07994  361 PAAPLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAKK 440
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 146219843 1640 TSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQ 1698
Cdd:PRK07994  441 SEPAAASRARPVNSALERLASVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKA 499
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
1510-1744 1.27e-05

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 49.77  E-value: 1.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1510 ATAPSLSSSQTPGHPLLLAPTSShvpGLNSTVAPACSPVLVPASAL-------ASPFPSAPNPAPAQASLLAPASSASQA 1582
Cdd:pfam09770   83 GAPSVGPDSDLSQKTSTFSPCQS---GYEASTDPEYIPDLQPDPSLwgtapkpEPQPPQAPESQPQPQTPAQKMLSLEEV 159
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1583 LATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLA---SASPVPAPTPVLAPSS 1659
Cdd:pfam09770  160 EAQLQQRQQAPQLPQPPQQVLPQGMPPRQAAFPQQGPPEQPPGYPQPPQGHPEQVQPQQFLpapSQAPAQPPLPPQLPQQ 239
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1660 TQTMLPAPVPSPL--PSPASTQTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPG 1737
Cdd:pfam09770  240 PPPLQQPQFPGLSqqMPPPPPQPPQQQQQPPQPQAQPPPQNQPTPHPGLPQGQNAPLPPPQQPQLLPLVQQPQGQQRGPQ 319

                   ....*..
gi 146219843  1738 PPLGPTQ 1744
Cdd:pfam09770  320 FREQLVQ 326
mukB PRK04863
cell division protein MukB; Provisional
2253-2344 1.44e-05

cell division protein MukB; Provisional


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 49.57  E-value: 1.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2253 DIRAATQAKAEQVAELAEFNENDGFPAGEG-EEAGRPGAE--DEEMSRAEQEIAALVEQLTPIERyAMKFLEASLEEVSR 2329
Cdd:PRK04863 1024 SLKSSYDAKRQMLQELKQELQDLGVPADSGaEERARARRDelHARLSANRSRRNQLEKQLTFCEA-EMDNLTKKLRKLER 1102
                          90
                  ....*....|....*
gi 146219843 2330 eELKQAEEQVEAARK 2344
Cdd:PRK04863 1103 -DYHEMREQVVNAKA 1116
PTZ00121 PTZ00121
MAEBL; Provisional
2170-2362 1.73e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 49.37  E-value: 1.73e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2170 RTVEEniLKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSSSVPSAPEEEEETVASKQTHILEQALCRAE 2249
Cdd:PTZ00121 1552 KKAEE--LKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAE 1629
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2250 DE-EDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAGRPGAED----EEMSRAEQEIAALVEQLTPIERYAMKFLE--- 2321
Cdd:PTZ00121 1630 EEkKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDkkkaEEAKKAEEDEKKAAEALKKEAEEAKKAEElkk 1709
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 146219843 2322 ASLEEVSR-EELKQAEE----QVEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:PTZ00121 1710 KEAEEKKKaEELKKAEEenkiKAEEAKKEAEEDKKKAEEAKKDEEE 1755
SSL2 COG1061
DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and ...
2052-2179 1.92e-05

DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 48.59  E-value: 1.92e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2052 LRQLKAEGHRVLIFTQMTRMLDVLEQFLtYHGHLYLRLDGSTRVEQRQALMERFNADKRIfcFILSTRSGGVGVNLTGAD 2131
Cdd:COG1061   276 LLLKHARGDKTLIFASDVEHAYEIAKLF-LAPGIVEAITGETPKEEREAILERFRTGGIK--VLVTVKVLDEGVDIPDAD 352
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 146219843 2132 TVVFYDSDWNPTMDAQAQDRCHRI---GQTRDVHIYRLISERTVEENILKK 2179
Cdd:COG1061   353 VLIILRPTGSRRLFIQRLGRGLRPaegKEDTLALDYSLVPDDLGEEDIARR 403
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
2228-2362 2.86e-05

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 48.56  E-value: 2.86e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2228 EEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNE-----NDGFPAGEGE---EAGRPGAEDEEMSRAE 2299
Cdd:COG1196   755 ELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEeleeaERRLDALERElesLEQRRERLEQEIEELE 834
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 146219843 2300 QEIAALVEQLTPIERyAMKFLEASLEEvSREELKQAEEQVEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:COG1196   835 EEIEELEEKLDELEE-ELEELEKELEE-LKEELEELEAEKEELEDELKELEEEKEELEEELRE 895
PRK12727 PRK12727
flagellar biosynthesis regulator FlhF; Provisional
1527-1739 3.17e-05

flagellar biosynthesis regulator FlhF; Provisional


Pssm-ID: 237182 [Multi-domain]  Cd Length: 559  Bit Score: 48.06  E-value: 3.17e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1527 LAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAilapspappl 1606
Cdd:PRK12727   55 LETARSDTPATAAAPAPAPQAPTKPAAPVHAPLKLSANANMSQRQRVASAAEDMIAAMALRQPVSVPRQA---------- 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1607 aplpvlapsPGAAPVLASSqTPVPVMAPSSTPgtslASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPA 1686
Cdd:PRK12727  125 ---------PAAAPVRAAS-IPSPAAQALAHA----AAVRTAPRQEHALSAVPEQLFADFLTTAPVPRAPVQAPVVAAPA 190
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 146219843 1687 LAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPP 1739
Cdd:PRK12727  191 PVPAIAAALAAHAAYAQDDDEQLDDDGFDLDDALPQILPPAALPPIVVAPAAP 243
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1540-1866 5.58e-05

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 47.86  E-value: 5.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1540 TVAPACSPVLVPASALASPFPSAPNPaPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAA 1619
Cdd:PHA03307   69 TGPPPGPGTEAPANESRSTPTWSLST-LAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPAPDLSEMLRPVGSPGPP 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1620 PVLASSQTPVPVMAPSSTPGTSLASASPV---------PAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALA-- 1688
Cdd:PHA03307  148 PAASPPAAGASPAAVASDAASSRQAALPLsspeetaraPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGrs 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1689 ------PTLGGSSPSQTLSLGTG----NPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPAS 1758
Cdd:PHA03307  228 aaddagASSSDSSSSESSGCGWGpeneCPLPRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGP 307
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1759 PVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMV 1838
Cdd:PHA03307  308 APSSPRASSSSSSSRESSSSSTSSSSESSRGAAVSPGPSPSRSPSPSRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTR 387
                         330       340
                  ....*....|....*....|....*...
gi 146219843 1839 SRlpVSKDEPDTLTLRSGPPSPPSTATS 1866
Cdd:PHA03307  388 RR--ARAAVAGRARRRDATGRFPAGRPR 413
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
1544-1672 5.76e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 47.40  E-value: 5.76e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1544 ACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPlaPMAAPQTAilaPSPAPPLAPLPVLAPSPGAAPVLA 1623
Cdd:PRK14951  370 AEAAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAAS--APAAPPAA---APPAPVAAPAAAAPAAAPAAAPAA 444
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 1624 SSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPL 1672
Cdd:PRK14951  445 VALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAPAAARLTPTEE 493
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
1381-1678 6.60e-05

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 47.37  E-value: 6.60e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1381 PSPEVSASAPGAAPLTISSPLhVPSSLPGPASSPMPIPNSSPLASPVSSTVSVP--LSSSLPISVPTTLPAPASAPLTIP 1458
Cdd:pfam03154  182 QVPPGAALAPSAPPPTPSAQA-VPPQGSPIAAQPAPQPQQPSPLSLISAPSLHPqrLPSPHPPLQPQTASQQSPQPPAPS 260
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1459 ISAPLT-VSASGPALLTSVT-------PPLAPVVPAAPGPPSLAPSGASPSASALTLGLATA-PSLSSSQTP-GHPLLLA 1528
Cdd:pfam03154  261 SRHPQSsHHGPGPPMPHALQqgpvflqHPSSNPPQPFGLAQSQVPPLPLPSQAQPHSHTPPSqSALQPQQPPrEQPLPPA 340
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1529 PTSSHV----------------------------PGLNSTVAPAcsPVLVPASALASPFPSAPNPAPAQ----------- 1569
Cdd:pfam03154  341 PSMPHIkpppttpipqlpnqshkhpphlqgpspfPQMPSNLPPP--PALKPLSSLPTHHPPSAHPPPLQlmpqsqplqsv 418
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1570 ----------ASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPG 1639
Cdd:pfam03154  419 paqppvltqsQSLPPKASTHPHSGLHSGPPQSPFAQHPFTSGGLPAIGPPPSLPTSTPAAPPRASSGSQPPGSALPSSGG 498
                          330       340       350
                   ....*....|....*....|....*....|....*....
gi 146219843  1640 TSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPAST 1678
Cdd:pfam03154  499 CAGPGPPLPPIQIKEEPLDEAEEPESPPPPPRSPSPEPT 537
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1419-1628 8.62e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 46.79  E-value: 8.62e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1419 NSSPlASPVSSTVSVPLSSSLPISVPTtlPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGA 1498
Cdd:PRK12323  371 GAGP-ATAAAAPVAQPAPAAAAPAAAA--PAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGA 447
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1499 SPSASAL--TLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPA 1576
Cdd:PRK12323  448 PAPAPAPaaAPAAAARPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIP 527
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 146219843 1577 SSASQALATPLAPMAAPQTAILAPSPAPPLAPLPvlapsPGAAPVLASSQTP 1628
Cdd:PRK12323  528 DPATADPDDAFETLAPAPAAAPAPRAAAATEPVV-----APRPPRASASGLP 574
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
1381-1630 8.96e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 46.77  E-value: 8.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1381 PSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSV-PLSSSLPISVPTTLPAPASAPLTIPI 1459
Cdd:PRK07003  372 VPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEaPPAAPAPPATADRGDDAADGDAPVPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1460 SAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGhplllaptsshVPGLNS 1539
Cdd:PRK07003  452 KANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPA-----------AASRED 520
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1540 TVAPACSPVlvPASALASPFPSAP--NPAPAQASL---------------LAPASSASQALATPLAPM-AAPQTAILAPS 1601
Cdd:PRK07003  521 APAAAAPPA--PEARPPTPAAAAPaaRAGGAAAALdvlrnagmrvssdrgARAAAAAKPAAAPAAAPKpAAPRVAVQVPT 598
                         250       260
                  ....*....|....*....|....*....
gi 146219843 1602 PAPPLAPLPVLAPSPGAAPVLASSQTPVP 1630
Cdd:PRK07003  599 PRARAATGDAPPNGAARAEQAAESRGAPP 627
PHA03269 PHA03269
envelope glycoprotein C; Provisional
1537-1693 9.50e-05

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 46.65  E-value: 9.50e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1537 LNSTVAPACSPVLVPA-SALASPFPSAPNPAPAQASLLAP--ASSASQALATPLAPMAAPQT-AILAPSPAPPLAPLPVL 1612
Cdd:PHA03269   15 INLIIANLNTNIPIPElHTSAATQKPDPAPAPHQAASRAPdpAVAPTSAASRKPDLAQAPTPaASEKFDPAPAPHQAASR 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1613 APSPGAAPVLASSQTPVPVMAPSStpgtslasaSPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLG 1692
Cdd:PHA03269   95 APDPAVAPQLAAAPKPDAAEAFTS---------AAQAHEAPADAGTSAASKKPDPAAHTQHSPPPFAYTRSMEHIACTHG 165

                  .
gi 146219843 1693 G 1693
Cdd:PHA03269  166 G 166
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
1262-1578 1.08e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 46.69  E-value: 1.08e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1262 AVAPTPGPTPVSVLPSSTPS--TTPAPTGLSLPLAANQVPPTMVNNT---GVVKIVVRQAPRDGLTPVPPLAPAPRPPSS 1336
Cdd:pfam05109  448 AVPTTPSLPPASTGPTVSTAdpTSGTPTGTTSSTLPEDTSPTSRTTSatpNATSPTPAVTTPNATSPTTQKTSDTPNATS 527
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1337 GLPAVLNPRPTLtpgrlPTPTLGTARAPMPTPTLVRpllklvhSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPmp 1416
Cdd:pfam05109  528 PTPIVIGVTTTA-----TSPPTGTTSVPNATSPQVT-------EESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSP-- 593
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1417 ipnSSPLASPVSSTVSVPLSSSLPISVPTTLPAPA----------SAPLTIPISA------PLTVS-ASGPALL-TSVTP 1478
Cdd:pfam05109  594 ---TSQQPGIPSSSHSTPRSNSTSTTPLLTSAHPTggeniteetpSVPSTTHVSTlspgpgPGTTSqVSGPGNSsTSRYP 670
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1479 PLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSS--QTPGHPlLLAPTSSHVPGLNSTVAPACSPVLVPASALA 1556
Cdd:pfam05109  671 GEVHVTEGMPNPNATSPSAPSGQKTAVPTVTSTGGKANSTtkETSGST-LMASTSPHTNEGAFRTTPYNATTYLPPSTSS 749
                          330       340
                   ....*....|....*....|....*.
gi 146219843  1557 SPFP----SAPNPAPAQASLLAPASS 1578
Cdd:pfam05109  750 KLRPrwtfTSPPVTTKQATVPVPPTQ 775
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
1622-1730 1.49e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 45.92  E-value: 1.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1622 LASSQTPVPVMAPSSTPG-TSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPsPASTQTLALAPALAPTLGGSSPSQTL 1700
Cdd:PRK14971  386 PAAAPQPSAAAAASPSPSqSSAAAQPSAPQSATQPAGTPPTVSVDPPAAVPVN-PPSTAPQAVRPAQFKEEKKIPVSKVS 464
                          90       100       110
                  ....*....|....*....|....*....|
gi 146219843 1701 SLGTGNpQGPFPTQTLSLTPASSLVPTPAQ 1730
Cdd:PRK14971  465 SLGPST-LRPIQEKAEQATGNIKEAPTGTQ 493
PHA03378 PHA03378
EBNA-3B; Provisional
1615-1988 1.78e-04

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 45.83  E-value: 1.78e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1615 SPGAAPV-LASSQTPVPVMAPSSTPGTSlASASPVPAPTPVLAPSSTQTMLP---APVPSPLP-SPASTQTLALAPALAP 1689
Cdd:PHA03378  566 APGLGPLqIQPLTSPTTSQLASSAPSYA-QTPWPVPHPSQTPEPPTTQSHIPetsAPRQWPMPlRPIPMRPLRMQPITFN 644
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1690 TLGGSSPSQ------TLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLslAPGPPLGPTQTLSLAPAPPLAPASPVGPA 1763
Cdd:PHA03378  645 VLVFPTPHQppqveiTPYKPTWTQIGHIPYQPSPTGANTMLPIQWAPGT--MQPPPRAPTPMRPPAAPPGRAQRPAAATG 722
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1764 PAHTLTLAPASSSASLLAPasvqtltlSPAPVPTLGPAAAQTLALAPASTQSPAsqasslvvsASGAAPLPVTMVSRLPV 1843
Cdd:PHA03378  723 RARPPAAAPGRARPPAAAP--------GRARPPAAAPGRARPPAAAPGRARPPA---------AAPGAPTPQPPPQAPPA 785
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1844 SKDEPDTLTLRSGPPSPPSTATSFGGPRPRRQPPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGT--E 1921
Cdd:PHA03378  786 PQQRPRGAPTPQPPPQAGPTSMQLMPRAAPGQQGPTKQILRQLLTGGVKRGRPSLKKPAALERQAAAGPTPSPGSGTsdK 865
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146219843 1922 VLDFCTLPQPVASPIG-PRSPGPSHPTfwtyteAAHRAVLFPQQRLDQlseiiERFIFVMPPVEAPPP 1988
Cdd:PHA03378  866 IVQAPVFYPPVLQPIQvMRQLGSVRAA------AASTVTQAPTEYTGE-----RRGVGPMHPTDIPPS 922
PHA03378 PHA03378
EBNA-3B; Provisional
1360-1834 1.83e-04

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 45.83  E-value: 1.83e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1360 TARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSS-PLASPVSSTVSVPLSSS 1438
Cdd:PHA03378  444 TPHSQAPTVVLHRPPTQPLEGPTGPLSVQAPLEPWQPLPHPQVTPVILHQPPAQGVQAHGSMlDLLEKDDEDMEQRVMAT 523
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1439 LPISVPTTLPAPASAPLTIpiSAPLTVSASGPALLTSVTPPLAPVVpaapgppSLAPSGASPSASALTLGLATApslsss 1518
Cdd:PHA03378  524 LLPPSPPQPRAGRRAPCVY--TEDLDIESDEPASTEPVHDQLLPAP-------GLGPLQIQPLTSPTTSQLASS------ 588
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1519 qTPGHplllAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPmaaPQTAIL 1598
Cdd:PHA03378  589 -APSY----AQTPWPVPHPSQTPEPPTTQSHIPETSAPRQWPMPLRPIPMRPLRMQPITFNVLVFPTPHQP---PQVEIT 660
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1599 APSPAPPlaplpvlapSPGAAPVLASSQTPVPVMAPSSTPGTSLA-SASPVPAPTPVLAPSSTQ--TMLPAPVPSPLPSP 1675
Cdd:PHA03378  661 PYKPTWT---------QIGHIPYQPSPTGANTMLPIQWAPGTMQPpPRAPTPMRPPAAPPGRAQrpAAATGRARPPAAAP 731
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1676 ASTQTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPAS--SLVPTPAQTLSLAPGPPLGPTQTLSLAPAPP 1753
Cdd:PHA03378  732 GRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGAPTPQPppQAPPAPQQRPRGAPTPQPPPQAGPTSMQLMP 811
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1754 LAPASPVGPAPA---HTLTLAPASSSASLLAPASVQTL-TLSPAPVPTLGPAAAQTLA---LAPAST--QSPASQASSLV 1824
Cdd:PHA03378  812 RAAPGQQGPTKQilrQLLTGGVKRGRPSLKKPAALERQaAAGPTPSPGSGTSDKIVQApvfYPPVLQpiQVMRQLGSVRA 891
                         490
                  ....*....|
gi 146219843 1825 VSASGAAPLP 1834
Cdd:PHA03378  892 AAASTVTQAP 901
PHA03379 PHA03379
EBNA-3A; Provisional
1354-1740 1.85e-04

EBNA-3A; Provisional


Pssm-ID: 223066 [Multi-domain]  Cd Length: 935  Bit Score: 45.82  E-value: 1.85e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1354 PTPTLGTARAPMPTPtlvRPLLKLVHSPSPE---VSASAPGAAPLTISSPLHVPSSL-PGPASS--PMPIPNSSP---LA 1424
Cdd:PHA03379  409 SEPTYGTPRPPVEKP---RPEVPQSLETATShgsAQVPEPPPVHDLEPGPLHDQHSMaPCPVAQlpPGPLQDLEPgdqLP 485
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1425 SPVSStvsvplssslPISVPTTLPAPA--------SAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPS 1496
Cdd:PHA03379  486 GVVQD----------GRPACAPVPAPAgpivrpweASLSQVPGVAFAPVMPQPMPVEPVPVPTVALERPVCPAPPLIAMQ 555
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1497 GASPSASALTLGLATAPSlSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAP----AQASL 1572
Cdd:PHA03379  556 GPGETSGIVRVRERWRPA-PWTPNPPRSPSQMSVRDRLARLRAEAQPYQASVEVQPPQLTQVSPQQPMEYPlepeQQMFP 634
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1573 LAPASSASQALATPLAPMAAPQTAILapspapplaplpvlapspgaapvlaSSQTPVPVMAPSSTPGTSLASASPVPAPT 1652
Cdd:PHA03379  635 GSPFSQVADVMRAGGVPAMQPQYFDL-------------------------PLQQPISQGAPLAPLRASMGPVPPVPATQ 689
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1653 PvlapsstqTMLPAPVPSPLPSPAST-QTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLtPASSLVPTPAQT 1731
Cdd:PHA03379  690 P--------QYFDIPLTEPINQGASAaHFLPQQPMEGPLVPERWMFQGATLSQSVRPGVAQSQYFDL-PLTQPINHGAPA 760

                  ....*....
gi 146219843 1732 LSLAPGPPL 1740
Cdd:PHA03379  761 AHFLHQPPM 769
SrmB COG0513
Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / ...
2044-2158 2.04e-04

Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]


Pssm-ID: 223587 [Multi-domain]  Cd Length: 513  Bit Score: 45.55  E-value: 2.04e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2044 KLQTLAVLLRQLKAEghRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADK-RIfcfILSTRSGG 2122
Cdd:COG0513   260 KLELLLKLLKDEDEG--RVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGElRV---LVATDVAA 334
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 146219843 2123 VGVNLTGADTVVFYDSDWNPtmdaqaQDRCHRIGQT 2158
Cdd:COG0513   335 RGLDIPDVSHVINYDLPLDP------EDYVHRIGRT 364
Mating_C pfam12737
C-terminal domain of homeodomain 1; Mating in fungi is controlled by the loci that determine ...
1344-1584 2.10e-04

C-terminal domain of homeodomain 1; Mating in fungi is controlled by the loci that determine the mating type of an individual, and only individuals with differing mating types can mate. Basidiomycete fungi have evolved a unique mating system, termed tetrapolar or bifactorial incompatibility, in which mating type is determined by two unlinked loci; compatibility at both loci is required for mating to occur. The multi-allelic tetrapolar mating system is considered to be a novel innovation that could have only evolved once, and is thus unique to the mushroom fungi. This domain is C-terminal to the homeodomain transcription factor region.


Pssm-ID: 257262 [Multi-domain]  Cd Length: 418  Bit Score: 45.18  E-value: 2.10e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1344 PRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAPLTISS----------------PLHVPSSL 1407
Cdd:pfam12737  127 PRSDSISSSSSPAKPPEACLPSPAASTQDELSEASAAPLPTPSLSPPHTPTDTAPSgkrkrrlsdgfqlpapKRPQTSSR 206
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1408 PGPASSPMPIPNSSPLA----SPVSSTVSVPLSSSLPISVPTTLPaPASAPLTIPISAPLTVSASGPALLTSVTPPLAPV 1483
Cdd:pfam12737  207 PQTVSDPLPLHATTDWDtwfqATVSSSPSLLLTGDIPPPVSVFAP-DDSTPLDISLFNFPLIPLLPPEALDLPAPTAVSS 285
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1484 VPAAPGPPSLAPSGASPSASALTLGLatapslSSSQTPGHPLLLAPT---------SSHVPGLNSTVAPACSPVLVP--- 1551
Cdd:pfam12737  286 SSSTFAVPALTSSSVDQSATPLDQGF------SNFGSNMYSEPLNPTndsllyglpSSSSLYANRTIFPAWASTSVSpld 359
                          250       260       270
                   ....*....|....*....|....*....|....*...
gi 146219843  1552 ASALAS-PFPSAPNP----APAQASLLAPASSASQALA 1584
Cdd:pfam12737  360 FSTLFNqPSPSPMASqsilAPAQPTSPSPVALPSSELE 397
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
1449-1802 2.33e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 45.61  E-value: 2.33e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1449 APASAPLTIPISAPLTVSASGPALLTSVTPPlapvvpAAPGPPSLAPSGASPSASALtlglATAPSLSSSQtpghplllA 1528
Cdd:PRK07003  372 VPARVAGAVPAPGARAAAAVGASAVPAVTAV------TGAAGAALAPKAAAAAAATR----AEAPPAAPAP--------P 433
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1529 PTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAP 1608
Cdd:PRK07003  434 ATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDARAP 513
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1609 LPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTS-----------------------LASASPVPAPTPVLAPSSTQTMLP 1665
Cdd:PRK07003  514 AAASREDAPAAAAPPAPEARPPTPAAAAPAARAggaaaaldvlrnagmrvssdrgaRAAAAAKPAAAPAAAPKPAAPRVA 593
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1666 APVPSP----LPSPASTQTLALAPALAPTLGGSSPSQTLSlgtGNPQGPFPTQTLSLTPASSLVP---TPAQTLSLAPGP 1738
Cdd:PRK07003  594 VQVPTPraraATGDAPPNGAARAEQAAESRGAPPPWEDIP---PDDYVPLSADEGFGGPDDGFVPvfdSGPDDVRVAPKP 670
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 146219843 1739 PLGPTQTLSLAPAPPLAPASPVG-----PAPAHTLTLAPAS---SSASLLAPASVQTLTLSpAPVPTLGPAA 1802
Cdd:PRK07003  671 ADAPAPPVDTRPLPPAIPLDAIGfdgewPALAARLPLKGVAyqlAFNSELTAADGGTLKLA-VPVPQYADAA 741
PHA03379 PHA03379
EBNA-3A; Provisional
1518-1744 2.81e-04

EBNA-3A; Provisional


Pssm-ID: 223066 [Multi-domain]  Cd Length: 935  Bit Score: 45.43  E-value: 2.81e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1518 SQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASL--------LAPASSASQALATPLAP 1589
Cdd:PHA03379  468 AQLPPGPLQDLEPGDQLPGVVQDGRPACAPVPAPAGPIVRPWEASLSQVPGVAFApvmpqpmpVEPVPVPTVALERPVCP 547
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1590 mAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVmapSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVP 1669
Cdd:PHA03379  548 -APPLIAMQGPGETSGIVRVRERWRPAPWTPNPPRSPSQMSV---RDRLARLRAEAQPYQASVEVQPPQLTQVSPQQPME 623
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 146219843 1670 SPLPSPASTQTLALAPALAPTLGGSspsqtlslgtGNPQGPFPTQTLSLT-PASSLVPTPAQTLSLAPGPPLGPTQ 1744
Cdd:PHA03379  624 YPLEPEQQMFPGSPFSQVADVMRAG----------GVPAMQPQYFDLPLQqPISQGAPLAPLRASMGPVPPVPATQ 689
PHA03269 PHA03269
envelope glycoprotein C; Provisional
1616-1724 2.97e-04

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 45.10  E-value: 2.97e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1616 PGAAPVLASSQTPVPVMAPsstpgTSLASASPVPAPtpvlAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSS 1695
Cdd:PHA03269   56 PAVAPTSAASRKPDLAQAP-----TPAASEKFDPAP----APHQAASRAPDPAVAPQLAAAPKPDAAEAFTSAAQAHEAP 126
                          90       100
                  ....*....|....*....|....*....
gi 146219843 1696 PSQTLSLGTGNPQGPFPTQTlslTPASSL 1724
Cdd:PHA03269  127 ADAGTSAASKKPDPAAHTQH---SPPPFA 152
PLN02321 PLN02321
2-isopropylmalate synthase
1768-1866 3.10e-04

2-isopropylmalate synthase


Pssm-ID: 215182 [Multi-domain]  Cd Length: 632  Bit Score: 44.96  E-value: 3.10e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1768 LTLAPASSSASLLAPASVQTlTLSPAPVPTLGPAAAQTlALAPASTQSPASQASSLVVSASGAAPLPVTMVSR-----LP 1842
Cdd:PLN02321    1 ILRSPNLSSATAASPAKSLS-AFTPAPTRSSASSARFP-AFLARPAAARSPSLASRASSALAASPSRPQVARRprpeyIP 78
                          90       100       110
                  ....*....|....*....|....*....|
gi 146219843 1843 VSKDEP------DTlTLRSGPPSPPSTATS 1866
Cdd:PLN02321   79 NRIDDPnyvrifDT-TLRDGEQSPGATLTS 107
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
1565-1843 3.13e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 45.23  E-value: 3.13e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1565 PAPAQASLLAPASSASQALATPL-APMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPS-STPGTSL 1642
Cdd:PRK07003  360 PAVTGGGAPGGGVPARVAGAVPApGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPApPATADRG 439
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1643 ASASPVPAPTPVLAPSstqtmlPAPVPSPLPSPASTQTLALAPALAPTlggsspsqtlslgtgnPQGPFPTQTLSLTPAS 1722
Cdd:PRK07003  440 DDAADGDAPVPAKANA------RASADSRCDERDAQPPADSGSASAPA----------------SDAPPDAAFEPAPRAA 497
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1723 SLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSA-SLLAPASVQTLT-LSPAPVPTLGP 1800
Cdd:PRK07003  498 APSAATPAAVPDARAPAAASREDAPAAAAPPAPEARPPTPAAAAPAARAGGAAAAlDVLRNAGMRVSSdRGARAAAAAKP 577
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 1801 AAAQTLALAPA------STQSPASQASSLVVSASGAAPLPVTMVSRLPV 1843
Cdd:PRK07003  578 AAAPAAAPKPAaprvavQVPTPRARAATGDAPPNGAARAEQAAESRGAP 626
chromosome_segregation_protein_related_ptotein TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2228-2362 3.45e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 45.06  E-value: 3.45e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2228 EEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAEL---------------AEFNENDGFPAGEGEEAGRpgaED 2292
Cdd:TIGR02169  343 REIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETrdelkdyrekleklkREINELKRELDRLQEELQR---LS 419
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2293 EEMSRAEQEIAALVEQLTPieryamkfLEASLEEVsREELKQAEEQVEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:TIGR02169  420 EELADLNAAIAGIEAKINE--------LEEEKEDK-ALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDR 480
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
1380-1503 4.06e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 44.71  E-value: 4.06e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1380 SPSPEVSASAPGAAPLTISSPlhVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPlSSSLPISVPTTLPAPASAPLTIPI 1459
Cdd:PRK14951  373 AAPAEKKTPARPEAAAPAAAP--VAQAAAAPAPAAAPAAAASAPAAPPAAAPPAP-VAAPAAAAPAAAPAAAPAAVALAP 449
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 146219843 1460 SAPLTVSASGPALLTSVTPPLAPVVPAApgppslAPSGASPSAS 1503
Cdd:PRK14951  450 APPAQAAPETVAIPVRVAPEPAVASAAP------APAAAPAAAR 487
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
1339-1471 4.50e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 44.32  E-value: 4.50e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1339 PAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPllklVHSPSPEVSASAPGAAPltissPLHVPSSLPGPASSPMPIP 1418
Cdd:PRK14951  378 KKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAAS----APAAPPAAAPPAPVAAP-----AAAAPAAAPAAAPAAVALA 448
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 146219843 1419 NSSPLASPvSSTVSVPLSSSLPISVPTTLPAPASApltiPISAPLTVSASGPA 1471
Cdd:PRK14951  449 PAPPAQAA-PETVAIPVRVAPEPAVASAAPAPAAA----PAAARLTPTEEGDV 496
PRK11901 PRK11901
hypothetical protein; Reviewed
1635-1793 5.44e-04

hypothetical protein; Reviewed


Pssm-ID: 237015 [Multi-domain]  Cd Length: 327  Bit Score: 43.52  E-value: 5.44e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1635 SSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPV------PSPLPSPASTQTLALAPALAPTLggsspSQTLSLGTGNPQ 1708
Cdd:PRK11901   91 NQSSPSAANNTSDGHDASGVKNTAPPQDISAPPIsptptqAAPPQTPNGQQRIELPGNISDAL-----SQQQGQVNAASQ 165
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1709 GpfptqtlSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSS----------AS 1778
Cdd:PRK11901  166 N-------AQGNTSTLPTAPATVAPSKGAKVPATAETHPTPPQKPATKKPAVNHHKTATVAVPPATSGkpksgaasarAL 238
                         170
                  ....*....|....*
gi 146219843 1779 LLAPASVQTLTLSPA 1793
Cdd:PRK11901  239 SSAPASHYTLQLSSA 253
PHA03378 PHA03378
EBNA-3B; Provisional
1218-1577 6.00e-04

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 44.29  E-value: 6.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1218 LTGAQVRQLAVGQPRPLQRNvvHLVSAGGQHHliSQPAHVALIQAV-APTPGPTPVSVLPSSTPSTTPAP---TGLSLPL 1293
Cdd:PHA03378  577 LTSPTTSQLASSAPSYAQTP--WPVPHPSQTP--EPPTTQSHIPETsAPRQWPMPLRPIPMRPLRMQPITfnvLVFPTPH 652
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1294 AANQVPPTMVNNTGVVKIVVRQAPRdgltpvpPLAPAPRPPSSGLPAVLNPrPTLTPGRLPTPTL--GTARAPMPTPTLV 1371
Cdd:PHA03378  653 QPPQVEITPYKPTWTQIGHIPYQPS-------PTGANTMLPIQWAPGTMQP-PPRAPTPMRPPAAppGRAQRPAAATGRA 724
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1372 RPLLKLVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSsplASPVSSTVSVPLSSSLPISVPTTLPAPA 1451
Cdd:PHA03378  725 RPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGA---PTPQPPPQAPPAPQQRPRGAPTPQPPPQ 801
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1452 SAPLTIPISAPLTVSASGPA------LLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTlglatapslsSSQTPGHPL 1525
Cdd:PHA03378  802 AGPTSMQLMPRAAPGQQGPTkqilrqLLTGGVKRGRPSLKKPAALERQAAAGPTPSPGSGT----------SDKIVQAPV 871
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....
gi 146219843 1526 LLAP--TSSHVPGLNSTVAPACspvlvpasalASPFPSAPNPAPAQASLLAPAS 1577
Cdd:PHA03378  872 FYPPvlQPIQVMRQLGSVRAAA----------ASTVTQAPTEYTGERRGVGPMH 915
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
1542-1698 6.95e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 43.70  E-value: 6.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1542 APACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPlaPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPV 1621
Cdd:PRK07994  367 EPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAP--AVPLPETTSQLLAARQQLQRAQGATKAKKSEPA 444
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 146219843 1622 LASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLAL--APALAPTLGGSSPSQ 1698
Cdd:PRK07994  445 AASRARPVNSALERLASVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKALKKALEHekTPELAAKLAAEAIER 523
PHA02682 PHA02682
ORF080 virion core protein; Provisional
1543-1700 7.49e-04

ORF080 virion core protein; Provisional


Pssm-ID: 177464 [Multi-domain]  Cd Length: 280  Bit Score: 42.93  E-value: 7.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1543 PACSPVLVPASALASPFPSAPNPAPAqasllAPASSASQALATPLAPMAAPQTAilapspapplaplpvlaPSPGAAPVL 1622
Cdd:PHA02682   76 PSGQSPLAPSPACAAPAPACPACAPA-----APAPAVTCPAPAPACPPATAPTC-----------------PPPAVCPAP 133
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146219843 1623 ASSqtpvpvmAPSSTPGTSLASASPvPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTL 1700
Cdd:PHA02682  134 ARP-------APACPPSTRQCPPAP-PLPTPKPAPAAKPIFLHNQLPPPDYPAASCPTIETAPAASPVLEPRIPDKII 203
PRK02292 PRK02292
V-type ATP synthase subunit E; Provisional
2231-2352 7.63e-04

V-type ATP synthase subunit E; Provisional


Pssm-ID: 235026 [Multi-domain]  Cd Length: 188  Bit Score: 41.91  E-value: 7.63e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2231 ETVASKqthILEQALCRAEDeedIRAATQAKAEQVAELAEfnendgfpagegEEAGRPGAEDEEmsRAEQEIAALVEQ-L 2309
Cdd:PRK02292    4 ETVVED---IRDEARARASE---IRAEADEEAEEIIAEAE------------ADAEEILEDREA--EAEREIEQLREQeL 63
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 146219843 2310 TPIEryamkfLEASLE--EVSREELKQAEEQVEAARKDLDQAKEE 2352
Cdd:PRK02292   64 SSAK------LEAKRErlNARKEVLEDVRNQVEDEIASLDGDKRE 102
motB PRK12799
flagellar motor protein MotB; Reviewed
1550-1677 9.31e-04

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 43.17  E-value: 9.31e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1550 VPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVlasSQTPV 1629
Cdd:PRK12799  301 VAAVTPSSAVTQSSAITPSSAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSDVTLPGTVALPAAEPV---NMQPQ 377
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 146219843 1630 PVMAPSSTPGTSLASASPVPAPTpvlapsstqTMLPA-PVPSPLPSPAS 1677
Cdd:PRK12799  378 PMSTTETQQSSTGNITSTANGPT---------TSLPAaPASNIPVSPTS 417
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1252-1461 1.20e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 43.33  E-value: 1.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1252 SQPAHVALIQAVAPTPG---PTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDGLTPVPPLA 1328
Cdd:PRK12323  372 AGPATAAAAPVAQPAPAaaaPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPA 451
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1329 PAPRPPSSGL--PAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKL-VHSPSPEVSASAPGAAPLtissplhVPS 1405
Cdd:PRK12323  452 PAPAAAPAAAarPAAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELpPEFASPAPAQPDAAPAGW-------VAE 524
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 146219843 1406 SLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTtlPAPASAPLTIPISA 1461
Cdd:PRK12323  525 SIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPR--PPRASASGLPDMFD 578
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1464-1694 1.46e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 43.05  E-value: 1.46e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1464 TVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAP 1543
Cdd:PRK07764  587 VVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGG 666
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1544 ACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPlpvlapSPGAAPVLA 1623
Cdd:PRK07764  667 DGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAP------SPAADDPVP 740
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 146219843 1624 SSQTPVPVMAPSSTPGTSLASASPVPAPTPVlapsstqtmlPAPVPSPLPSPASTQTLALAPALAPTLGGS 1694
Cdd:PRK07764  741 LPPEPDDPPDPAGAPAQPPPPPAPAPAAAPA----------AAPPPSPPSEEEEMAEDDAPSMDDEDRRDA 801
PHA03378 PHA03378
EBNA-3B; Provisional
1252-1674 1.78e-03

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 42.75  E-value: 1.78e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1252 SQPAHVALIqavaPTPGPTPVSVLPSSTPST----TPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDGLTPVPPL 1327
Cdd:PHA03378  556 TEPVHDQLL----PAPGLGPLQIQPLTSPTTsqlaSSAPSYAQTPWPVPHPSQTPEPPTTQSHIPETSAPRQWPMPLRPI 631
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1328 APAPRPPSsglPAVLN----PRPTLTPGRLPTPTLGTARAPMPTPtlvrpllklvHSPSPEVSASA--PGAAPLTISSPL 1401
Cdd:PHA03378  632 PMRPLRMQ---PITFNvlvfPTPHQPPQVEITPYKPTWTQIGHIP----------YQPSPTGANTMlpIQWAPGTMQPPP 698
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1402 HVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLA 1481
Cdd:PHA03378  699 RAPTPMRPPAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAAAPGAPTPQP 778
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1482 PVVPAAPGPPSlaPSGAsPSASALTLGLATAPSLSSSQTPGHPlllAPTSSHVPGLNSTVAPACSPVLVPASALASPFPS 1561
Cdd:PHA03378  779 PPQAPPAPQQR--PRGA-PTPQPPPQAGPTSMQLMPRAAPGQQ---GPTKQILRQLLTGGVKRGRPSLKKPAALERQAAA 852
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1562 APNPAPaQASLLAPASSASQALATPLAPMAAPQTAilapspapplaplpvlapsPGAAPVLASSQTPVPVMAPSSTPGTS 1641
Cdd:PHA03378  853 GPTPSP-GSGTSDKIVQAPVFYPPVLQPIQVMRQL-------------------GSVRAAAASTVTQAPTEYTGERRGVG 912
                         410       420       430
                  ....*....|....*....|....*....|...
gi 146219843 1642 LASASPVPAPTPVLAPSSTQTMLPAPVPSPLPS 1674
Cdd:PHA03378  913 PMHPTDIPPSKRAKTDAYVESQPPHGGQSHSFS 945
TFIIA pfam03153
Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a ...
1559-1731 1.79e-03

Transcription factor IIA, alpha/beta subunit; Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription.


Pssm-ID: 251762 [Multi-domain]  Cd Length: 302  Bit Score: 42.04  E-value: 1.79e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1559 FPSAPNPAPAQASLLAPassasQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTP 1638
Cdd:pfam03153   47 FPWDPSPPAPPPPLQLP-----QPLPPPPQAPPALQALPAGDAQQHNTPTSSPAAAPPAAFATPAGMGAGPTIQTPPGQL 121
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1639 GTS-LASASPVPAPTPVLAPsSTQTMLPAPVPSPLPSPASTQTLALAPALAPtlGGSSPSQTLSLGTGNPQGPFPTQTLS 1717
Cdd:pfam03153  122 YQVnVPVMVNQNSANSQLAQ-PAQERAAQQLTQRYGAPASGQASVLQQQPAP--VQSNDESQLQQQPNGLIPPQQTDGAG 198
                          170
                   ....*....|....
gi 146219843  1718 LTPASSLVPTPAQT 1731
Cdd:pfam03153  199 DQESEASVPRRLEA 212
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
1551-1678 1.83e-03

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 42.24  E-value: 1.83e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1551 PASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVP 1630
Cdd:PTZ00436  222 PAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAAPAK 301
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 146219843 1631 VMAPSSTPGTSLASASPVPAPTPvlAPSSTQTMLPAPVPSPlPSPAST 1678
Cdd:PTZ00436  302 AAAAPAKAAAAPAKAAAPPAKAA--APPAKAATPPAKAAAP-PAKAAA 346
Trichoplein pfam13868
tumor suppressor, Mitostatin; Trichoplein or mitostatin, was first defined as a ...
2239-2362 2.00e-03

tumor suppressor, Mitostatin; Trichoplein or mitostatin, was first defined as a meiosis-specific nuclear structural protein. It has since been linked with mitochondrial movement. It is associated with the mitochondrial outer membrane, and over-expression leads to reduction in mitochondrial motility whereas lack of it enhances mitochondrial movement. The activity appears to be mediated through binding the mitochondria to the actin intermediate filaments (IFs).


Pssm-ID: 258135 [Multi-domain]  Cd Length: 350  Bit Score: 41.82  E-value: 2.00e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2239 HILEQALCRAED-EEDIRAATQAKAEQVAELAEFNEndgfpagegEEAgrpgAEDEEMSRAEQEIAALVE--QLTPIERY 2315
Cdd:pfam13868   25 QIEEKKRIKEEEkEEERRIDEMMEEERLKALAEEEE---------RER----KRKEERREGRAVLQEQIEerEKRRQEEY 91
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 146219843  2316 AMKFLEASL-----EEVSREELKQAEEQ---VEAARKDLDQAKEEVFRLPQEEEE 2362
Cdd:pfam13868   92 EERLQEREQmdeivERIQEEDEAEAQEKrekQKRLREEIDEFNEERIEWKEEEKE 146
COG5651 COG5651
PPE-repeat proteins [Cell motility and secretion]
1623-1836 2.03e-03

PPE-repeat proteins [Cell motility and secretion]


Pssm-ID: 227938 [Multi-domain]  Cd Length: 490  Bit Score: 42.22  E-value: 2.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1623 ASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLSL 1702
Cdd:COG5651   161 AASALTPFNEPPPTTNSSGLAAQASAVQALGDLASGITLASQVNLSLLELINPATLSGLANGGTGNLGIGALQQAQNLGF 240
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1703 GTgnpqgPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAP 1782
Cdd:COG5651   241 GN-----VGFGNLGSGNPGAPGLASQFSATNLGTLLGSLNPYLGNIGATNIGLAAAGTGNIGSGNAVDSGGSALVGAIGQ 315
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 146219843 1783 ASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVT 1836
Cdd:COG5651   316 TSQATANAGSVNATGGAAAGSGNLGVANSGSAAAPFGIAGANQAALGGANSGAG 369
PHA03269 PHA03269
envelope glycoprotein C; Provisional
1700-1858 2.10e-03

envelope glycoprotein C; Provisional


Pssm-ID: 165527 [Multi-domain]  Cd Length: 566  Bit Score: 42.41  E-value: 2.10e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1700 LSLGTGNPQGPFPTQTLSLTPASSL---VPTPAQTLSLAPGPPLGPTQTLSLApapplapaspvgPAPAhtltlapasss 1776
Cdd:PHA03269   15 INLIIANLNTNIPIPELHTSAATQKpdpAPAPHQAASRAPDPAVAPTSAASRK------------PDLA----------- 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1777 aslLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSG 1856
Cdd:PHA03269   72 ---QAPTPAASEKFDPAPAPHQAASRAPDPAVAPQLAAAPKPDAAEAFTSAAQAHEAPADAGTSAASKKPDPAAHTQHSP 148

                  ..
gi 146219843 1857 PP 1858
Cdd:PHA03269  149 PP 150
TALPID3 pfam15324
Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for ...
1647-1828 2.38e-03

Hedgehog signalling target; TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.


Pssm-ID: 259457 [Multi-domain]  Cd Length: 1180  Bit Score: 42.17  E-value: 2.38e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1647 PVPAPTPVLAP-SSTQTMLPAPVPSPLPSPAST-QTLALAPALAPTL---GGSSPSQTlslgtgNPQGPFP-----TQTL 1716
Cdd:pfam15324  850 QVPAATSVPGDvSTNETYLPARVCTPVATPQPTpPPSPPSPPKELVLvktPDSSPCVS------DHDGAFPvkeilAEKG 923
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  1717 SLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLA-----PASSSASLLAPASV------ 1785
Cdd:pfam15324  924 SDMPAITLVNTPVVTPVTTPPPAATPTPTLSEISIDKLKRSSPELPKPWDDGDLPleeenPNPLQEEPLHPRAIvmsvan 1003
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 146219843  1786 ----QTLTLSPAPVPtLGPAAAQTL---ALAPASTQSPASQASSLVVSAS 1828
Cdd:pfam15324 1004 deepESLDFPAQPAP-PEPVPFTPLpcgAKAPSPVQTPSSDSSTQESSLS 1052
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
1466-1693 2.64e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 42.28  E-value: 2.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1466 SASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPAC 1545
Cdd:PRK07764  599 GPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAP 678
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1546 SPVlVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASS 1625
Cdd:PRK07764  679 AAP-PPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEPDDPPDPAGAPAQ 757
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146219843 1626 QTPVPVMAPsstpgtslasASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGG 1693
Cdd:PRK07764  758 PPPPPAPAP----------AAAPAAAPPPSPPSEEEEMAEDDAPSMDDEDRRDAEEVAMELLEEELGA 815
Chromosome_partition_protein_Smc TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
2235-2353 2.65e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 42.35  E-value: 2.65e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843  2235 SKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAGRP-GAEDEEMSRAEQEIAALVEQLTPIE 2313
Cdd:TIGR02168  674 ERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQiSALRKDLARLEAEVEQLEERIAQLS 753
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*.
gi 146219843  2314 RyAMKFLEASLEEV------SREELKQAEEQVEAARKDLDQAKEEV 2353
Cdd:TIGR02168  754 K-ELTELEAEIEELeerleeAEEELAEAEAEIEELEAQIEQLKEEL 798
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
1315-1528 2.98e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 41.79  E-value: 2.98e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1315 QAPRDGLTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAP 1394
Cdd:PRK12323  379 AAPVAQPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPAPAAAP 458
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1395 LTISSPlHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLT 1474
Cdd:PRK12323  459 AAAARP-AAAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPATADPDDA 537
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 146219843 1475 SVTPPLAPVVPAAPgppslAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLA 1528
Cdd:PRK12323  538 FETLAPAPAAAPAP-----RAAAATEPVVAPRPPRASASGLPDMFDGDWPALAA 586
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
1542-1651 3.17e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 41.62  E-value: 3.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1542 APACSPVLVPASALAsPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAilAPSPAPPLAPLPVLAPSPGAAPV 1621
Cdd:PRK14951  388 APAAAPVAQAAAAPA-PAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAAAPAAA--PAAVALAPAPPAQAAPETVAIPV 464
                          90       100       110
                  ....*....|....*....|....*....|
gi 146219843 1622 LASSQTPVPVMAPSSTPGTslASASPVPAP 1651
Cdd:PRK14951  465 RVAPEPAVASAAPAPAAAP--AAARLTPTE 492
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
1440-1675 3.22e-03

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 41.84  E-value: 3.22e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1440 PISVPTTLPAPASaPLTIPISAPLTVSASGPALLTSVTP-PLAPVVPAAPGPPSLAPSGASPSASAltlglATAPSLSSS 1518
Cdd:PLN03209  331 KESDAADGPKPVP-TKPVTPEAPSPPIEEEPPQPKAVVPrPLSPYTAYEDLKPPTSPIPTPPSSSP-----ASSKSVDAV 404
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1519 QTPGhplllAPTSSHVPGLNSTVaPACSPVLVPASALA--SPF--------PSAPNPAPAQASLLaPASSASQALATPLA 1588
Cdd:PLN03209  405 AKPA-----EPDVVPSPGSASNV-PEVEPAQVEAKKTRplSPYaryedlkpPTSPSPTAPTGVSP-SVSSTSSVPAVPDT 477
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 1589 PMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPT--------PVLAPSST 1660
Cdd:PLN03209  478 APATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPAAPVGKVAPSSTNEVVKVGNSAPPTALadeqhhaqPKPRPLSP 557
                         250
                  ....*....|....*..
gi 146219843 1661 QTMLP--APVPSPLPSP 1675
Cdd:PLN03209  558 YTMYEdlKPPTSPTPSP 574
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
2228-2359 3.22e-03

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.01  E-value: 3.22e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146219843 2228 EEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAEL