NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|42558283|ref|NP_003995.2|]
View 

gap junction beta-2 protein [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Connexin pfam00029
Connexin;
2-108 4.06e-69

Connexin;


:

Pssm-ID: 143818  Cd Length: 107  Bit Score: 209.73  E-value: 4.06e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42558283     2 DWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQL 81
Cdd:pfam00029   1 DWSFLGRLLDGVQKHSTVIGKVWLTVLFIFRILVLGVAAESVWGDEQSDFVCNTLQPGCENVCYDQFFPISHIRFWVLQI 80
                          90       100
                  ....*....|....*....|....*..
gi 42558283    82 IFVSTPALLVAMHVAYRRHEKKRKFIK 108
Cdd:pfam00029  81 IFVSTPSLLYLGHVAHRIRKEKKHREK 107
Connexin_CCC smart01089
Gap junction channel protein cysteine-rich domain;
146-213 3.07e-35

Gap junction channel protein cysteine-rich domain;


:

Pssm-ID: 198157  Cd Length: 67  Bit Score: 121.06  E-value: 3.07e-35
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 42558283    146 FEAAFMYVFYVMYdGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
Cdd:smart01089   1 LEVGFLYGQYYLY-GFQVPPLYKCSRSPCPNTVDCFVSRPTEKTIFLIFMLVVSAICILLNLLELFYL 67
 
Name Accession Description Interval E-value
Connexin pfam00029
Connexin;
2-108 4.06e-69

Connexin;


Pssm-ID: 143818  Cd Length: 107  Bit Score: 209.73  E-value: 4.06e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42558283     2 DWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQL 81
Cdd:pfam00029   1 DWSFLGRLLDGVQKHSTVIGKVWLTVLFIFRILVLGVAAESVWGDEQSDFVCNTLQPGCENVCYDQFFPISHIRFWVLQI 80
                          90       100
                  ....*....|....*....|....*..
gi 42558283    82 IFVSTPALLVAMHVAYRRHEKKRKFIK 108
Cdd:pfam00029  81 IFVSTPSLLYLGHVAHRIRKEKKHREK 107
Connexin_CCC smart01089
Gap junction channel protein cysteine-rich domain;
146-213 3.07e-35

Gap junction channel protein cysteine-rich domain;


Pssm-ID: 198157  Cd Length: 67  Bit Score: 121.06  E-value: 3.07e-35
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 42558283    146 FEAAFMYVFYVMYdGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
Cdd:smart01089   1 LEVGFLYGQYYLY-GFQVPPLYKCSRSPCPNTVDCFVSRPTEKTIFLIFMLVVSAICILLNLLELFYL 67
Connexin_CCC pfam10582
Gap junction channel protein cysteine-rich domain;
146-213 2.10e-34

Gap junction channel protein cysteine-rich domain;


Pssm-ID: 151113  Cd Length: 67  Bit Score: 119.15  E-value: 2.10e-34
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 42558283   146 FEAAFMYVFYVMYdGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
Cdd:pfam10582   1 LEVGFLVGQYYLY-GFQVPPLYKCSRSPCPNTVDCFVSRPTEKTIFLVFMLVVSAICILLNVAELFYL 67
CNX smart00037
Connexin homologues; Connexin channels participate in the regulation of signaling between ...
42-75 3.14e-23

Connexin homologues; Connexin channels participate in the regulation of signaling between developing and differentiated cell types.


Pssm-ID: 128352  Cd Length: 34  Bit Score: 89.04  E-value: 3.14e-23
                           10        20        30
                   ....*....|....*....|....*....|....
gi 42558283     42 EVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIR 75
Cdd:smart00037   1 SVWGDEQSDFVCNTQQPGCENVCYDQAFPISHVR 34
 
Name Accession Description Interval E-value
Connexin pfam00029
Connexin;
2-108 4.06e-69

Connexin;


Pssm-ID: 143818  Cd Length: 107  Bit Score: 209.73  E-value: 4.06e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42558283     2 DWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQL 81
Cdd:pfam00029   1 DWSFLGRLLDGVQKHSTVIGKVWLTVLFIFRILVLGVAAESVWGDEQSDFVCNTLQPGCENVCYDQFFPISHIRFWVLQI 80
                          90       100
                  ....*....|....*....|....*..
gi 42558283    82 IFVSTPALLVAMHVAYRRHEKKRKFIK 108
Cdd:pfam00029  81 IFVSTPSLLYLGHVAHRIRKEKKHREK 107
Connexin_CCC smart01089
Gap junction channel protein cysteine-rich domain;
146-213 3.07e-35

Gap junction channel protein cysteine-rich domain;


Pssm-ID: 198157  Cd Length: 67  Bit Score: 121.06  E-value: 3.07e-35
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 42558283    146 FEAAFMYVFYVMYdGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
Cdd:smart01089   1 LEVGFLYGQYYLY-GFQVPPLYKCSRSPCPNTVDCFVSRPTEKTIFLIFMLVVSAICILLNLLELFYL 67
Connexin_CCC pfam10582
Gap junction channel protein cysteine-rich domain;
146-213 2.10e-34

Gap junction channel protein cysteine-rich domain;


Pssm-ID: 151113  Cd Length: 67  Bit Score: 119.15  E-value: 2.10e-34
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 42558283   146 FEAAFMYVFYVMYdGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYL 213
Cdd:pfam10582   1 LEVGFLVGQYYLY-GFQVPPLYKCSRSPCPNTVDCFVSRPTEKTIFLVFMLVVSAICILLNVAELFYL 67
CNX smart00037
Connexin homologues; Connexin channels participate in the regulation of signaling between ...
42-75 3.14e-23

Connexin homologues; Connexin channels participate in the regulation of signaling between developing and differentiated cell types.


Pssm-ID: 128352  Cd Length: 34  Bit Score: 89.04  E-value: 3.14e-23
                           10        20        30
                   ....*....|....*....|....*....|....
gi 42558283     42 EVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIR 75
Cdd:smart00037   1 SVWGDEQSDFVCNTQQPGCENVCYDQAFPISHVR 34
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH