NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|426214088|ref|NP_001258766.1|]
View 

reticulocalbin-2 isoform b precursor [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EFh super family cl08302
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
65-121 2.33e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


The actual alignment was detected with superfamily member cd00051:

Pssm-ID: 298682 [Multi-domain]  Cd Length: 63  Bit Score: 41.38  E-value: 2.33e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 426214088  65 RLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDE 121
Cdd:cd00051    1 ELREAFRLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEE 57
EFh super family cl08302
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
209-274 2.87e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


The actual alignment was detected with superfamily member cd00051:

Pssm-ID: 298682 [Multi-domain]  Cd Length: 63  Bit Score: 40.99  E-value: 2.87e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 426214088 209 IQEALEEHDKNGDGFVSLEEF---LGDYRWDPTaneDPEWilvekDRFVNDYDKDNDGRLDPQELLPWV 274
Cdd:cd00051    2 LREAFRLFDKDGDGTISADELkaaLKSLGEGLS---EEEI-----DEMIREVDKDGDGKIDFEEFLELM 62
EFh super family cl08302
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
255-308 4.65e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


The actual alignment was detected with superfamily member cd00051:

Pssm-ID: 298682 [Multi-domain]  Cd Length: 63  Bit Score: 40.61  E-value: 4.65e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 426214088 255 NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:cd00051    7 RLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFLE 60
EF-hand_7 pfam13499
EF-hand domain pair;
257-308 2.45e-03

EF-hand domain pair;


:

Pssm-ID: 290234 [Multi-domain]  Cd Length: 65  Bit Score: 35.33  E-value: 2.45e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 426214088  257 YDKDNDGRLDPQELL----PWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:pfam13499   8 LDKDGDGYLDVEELLkalqSLGLKLTDEEVEELLEELFKEFDLDGDGRISFEEFLE 63
 
Name Accession Description Interval E-value
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
65-121 2.33e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 41.38  E-value: 2.33e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 426214088  65 RLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDE 121
Cdd:cd00051    1 ELREAFRLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEE 57
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
209-274 2.87e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 40.99  E-value: 2.87e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 426214088 209 IQEALEEHDKNGDGFVSLEEF---LGDYRWDPTaneDPEWilvekDRFVNDYDKDNDGRLDPQELLPWV 274
Cdd:cd00051    2 LREAFRLFDKDGDGTISADELkaaLKSLGEGLS---EEEI-----DEMIREVDKDGDGKIDFEEFLELM 62
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
255-308 4.65e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 40.61  E-value: 4.65e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 426214088 255 NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:cd00051    7 RLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFLE 60
EF-hand_7 pfam13499
EF-hand domain pair;
257-308 2.45e-03

EF-hand domain pair;


Pssm-ID: 290234 [Multi-domain]  Cd Length: 65  Bit Score: 35.33  E-value: 2.45e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 426214088  257 YDKDNDGRLDPQELL----PWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:pfam13499   8 LDKDGDGYLDVEELLkalqSLGLKLTDEEVEELLEELFKEFDLDGDGRISFEEFLE 63
PTZ00183 PTZ00183
centrin; Provisional
217-313 3.28e-03

centrin; Provisional


Pssm-ID: 185503 [Multi-domain]  Cd Length: 158  Bit Score: 36.59  E-value: 3.28e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426214088 217 DKNGDGFVSLEEFLgDYRWDPTANEDPEwilVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLN 296
Cdd:PTZ00183  63 DKDGSGKIDFEEFL-DIMTKKLGERDPR---EEILKAFRLFDDDKTGKISLKNLKRVAKELGETITDEELQEMIDEADRN 138
                         90       100
                 ....*....|....*....|
gi 426214088 297 GDKKLSEEE---ILENPDLF 313
Cdd:PTZ00183 139 GDGEISEEEfyrIMKKTNLF 158
FRQ1 COG5126
Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms];
257-305 5.23e-03

Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms];


Pssm-ID: 227455 [Multi-domain]  Cd Length: 160  Bit Score: 35.75  E-value: 5.23e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 426214088 257 YDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEE 305
Cdd:COG5126  101 FDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGEIDYEE 149
 
Name Accession Description Interval E-value
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
65-121 2.33e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 41.38  E-value: 2.33e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 426214088  65 RLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDE 121
Cdd:cd00051    1 ELREAFRLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEE 57
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
209-274 2.87e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 40.99  E-value: 2.87e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 426214088 209 IQEALEEHDKNGDGFVSLEEF---LGDYRWDPTaneDPEWilvekDRFVNDYDKDNDGRLDPQELLPWV 274
Cdd:cd00051    2 LREAFRLFDKDGDGTISADELkaaLKSLGEGLS---EEEI-----DEMIREVDKDGDGKIDFEEFLELM 62
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
255-308 4.65e-05

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 40.61  E-value: 4.65e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 426214088 255 NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:cd00051    7 RLFDKDGDGTISADELKAALKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFLE 60
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
187-230 1.99e-03

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 35.60  E-value: 1.99e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 426214088 187 LSLEEFIAFeHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFL 230
Cdd:cd00051   17 ISADELKAA-LKSLGEGLSEEEIDEMIREVDKDGDGKIDFEEFL 59
EF-hand_7 pfam13499
EF-hand domain pair;
257-308 2.45e-03

EF-hand domain pair;


Pssm-ID: 290234 [Multi-domain]  Cd Length: 65  Bit Score: 35.33  E-value: 2.45e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 426214088  257 YDKDNDGRLDPQELL----PWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILE 308
Cdd:pfam13499   8 LDKDGDGYLDVEELLkalqSLGLKLTDEEVEELLEELFKEFDLDGDGRISFEEFLE 63
PTZ00183 PTZ00183
centrin; Provisional
217-313 3.28e-03

centrin; Provisional


Pssm-ID: 185503 [Multi-domain]  Cd Length: 158  Bit Score: 36.59  E-value: 3.28e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426214088 217 DKNGDGFVSLEEFLgDYRWDPTANEDPEwilVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLN 296
Cdd:PTZ00183  63 DKDGSGKIDFEEFL-DIMTKKLGERDPR---EEILKAFRLFDDDKTGKISLKNLKRVAKELGETITDEELQEMIDEADRN 138
                         90       100
                 ....*....|....*....|
gi 426214088 297 GDKKLSEEE---ILENPDLF 313
Cdd:PTZ00183 139 GDGEISEEEfyrIMKKTNLF 158
PTZ00184 PTZ00184
calmodulin; Provisional
205-305 3.82e-03

calmodulin; Provisional


Pssm-ID: 185504 [Multi-domain]  Cd Length: 149  Bit Score: 35.89  E-value: 3.82e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 426214088 205 TEFVIQEALEEHDKNGDGFVSLEEFLgDYRWDPTANEDPEWILVEKDRFvndYDKDNDGRLDPQELLPWVVPNNQGIAQE 284
Cdd:PTZ00184  45 TEAELQDMINEVDADGNGTIDFPEFL-TLMARKMKDTDSEEEIKEAFKV---FDRDGNGFISAAELRHVMTNLGEKLTDE 120
                         90       100
                 ....*....|....*....|.
gi 426214088 285 EALHLIDEMDLNGDKKLSEEE 305
Cdd:PTZ00184 121 EVDEMIREADVDGDGQINYEE 141
FRQ1 COG5126
Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms];
257-305 5.23e-03

Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms];


Pssm-ID: 227455 [Multi-domain]  Cd Length: 160  Bit Score: 35.75  E-value: 5.23e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 426214088 257 YDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEE 305
Cdd:COG5126  101 FDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGEIDYEE 149
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH