NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|259490323|ref|NP_001159354|]
View 

zinc finger protein 268 isoform c [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
2-37 4.55e-16

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


:

Pssm-ID: 143639  Cd Length: 40  Bit Score: 73.74  E-value: 4.55e-16
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 259490323   2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL 37
Cdd:cd07765    5 DVAVYFSQEEWELLDPAQRDLYRDVMLENYENLVSL 40
zf-H2C2_2 pfam13465
Zinc-finger double domain;
627-651 4.90e-04

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.91  E-value: 4.90e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  627 YLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
347-371 6.26e-04

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.53  E-value: 6.26e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  347 NLMVHQRTHTGEKPYVCSDCGKAFT 371
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
711-734 1.33e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.76  E-value: 1.33e-03
                          10        20
                  ....*....|....*....|....
gi 259490323  711 YLIIHMRTHSGEKPYECNECGKAF 734
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
543-567 1.49e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.37  E-value: 1.49e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  543 NLIVHQRTHTGEKPYSCNECGKAFT 567
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
460-484 3.96e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 3.96e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  460 LIIHQRIHTGENPYECHECGKAFSR 484
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
656-680 4.47e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 4.47e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  656 LIVHQRIHTGENPYECSECGKAFNR 680
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
824-846 4.73e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 4.73e-03
                          10        20
                  ....*....|....*....|...
gi 259490323  824 LSAHQRTHTGEKPCKCTECGKAF 846
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
320-344 5.25e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  320 LIIHERIHTGEKPYECNECQKAFNT 344
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
516-540 5.25e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  516 LIIHQRTHTGEKPFECSECQKAFNT 540
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
768-792 6.21e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 6.21e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  768 LLVHQRMHTREKPYECSECGKAFIR 792
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
264-288 6.95e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.45  E-value: 6.95e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  264 LVIHQRIHTGENPYECCECGKVFSR 288
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
414-827 1.06e-16

FOG: Zn-finger [General function prediction only]


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 82.44  E-value: 1.06e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 414 MKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECN--NCGKAFSFKSQLIIHQRIHTGENPYECheCGKAFSRKYQLISH 491
Cdd:COG5048   31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDLN--SKSLPLSNSKASSS 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 492 QRTHAGEKPYECTDCgkAFGLKSQLIIHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTgEKPYSCNECGKAFTFKSQ 571
Cdd:COG5048  109 SLSSSSSNSNDNNLL--SSHSLPPSSRDPQLPDLLSISNLRNNPLPGNNSSSVNTPQSNSL-HPPLPANSLSKDPSSNLS 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 572 LIVHKGVHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:COG5048  186 LLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSL 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 652 FNSQLIVHQRIHTGE-------NPYECSECGKAFNRKDQLISHQRT--HAGE--KPYGCSE--CGKAFSSKSYLIIHMRT 718
Cdd:COG5048  266 PTASSQSSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILL 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 719 HSGEKPYECNEC-------GKAFIWKSLLIVHERTHAGVNPYKC--SQCEKSFSGKLRLLVHQRMHTREKPYEC--SECG 787
Cdd:COG5048  346 HTSISPAKEKLLnssskfsPLLNNEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCknPPCS 425
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
gi 259490323 788 KAFIRNSQLIVHQRTHSgEKPYGCNECGKTFSQKSILSAH 827
Cdd:COG5048  426 KSFNRHYNLIPHKKIHT-NHAPLLCSILKSFRRDLDLSNH 464
 
Name Accession Description Interval E-value
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
2-37 4.55e-16

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 73.74  E-value: 4.55e-16
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 259490323   2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL 37
Cdd:cd07765    5 DVAVYFSQEEWELLDPAQRDLYRDVMLENYENLVSL 40
KRAB smart00349
krueppel associated box;
2-58 5.56e-30

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 114.23  E-value: 5.56e-30
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 259490323     2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLGYQHTKPDIIFKLEQGEELCM 58
Cdd:smart00349   5 DVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQVPKPDLISQLEQGEEPWI 61
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
2-38 2.32e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 201743  Cd Length: 41  Bit Score: 86.07  E-value: 2.32e-20
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 259490323    2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLG 38
Cdd:pfam01352   5 DVAVDFTQEEWGLLDPAQRNLYRDVMLENYSNLVSLG 41
zf-H2C2_2 pfam13465
Zinc-finger double domain;
627-651 4.90e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.91  E-value: 4.90e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  627 YLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
347-371 6.26e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.53  E-value: 6.26e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  347 NLMVHQRTHTGEKPYVCSDCGKAFT 371
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
711-734 1.33e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.76  E-value: 1.33e-03
                          10        20
                  ....*....|....*....|....
gi 259490323  711 YLIIHMRTHSGEKPYECNECGKAF 734
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
543-567 1.49e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.37  E-value: 1.49e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  543 NLIVHQRTHTGEKPYSCNECGKAFT 567
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
460-484 3.96e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 3.96e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  460 LIIHQRIHTGENPYECHECGKAFSR 484
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
656-680 4.47e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 4.47e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  656 LIVHQRIHTGENPYECSECGKAFNR 680
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
824-846 4.73e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 4.73e-03
                          10        20
                  ....*....|....*....|...
gi 259490323  824 LSAHQRTHTGEKPCKCTECGKAF 846
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
320-344 5.25e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  320 LIIHERIHTGEKPYECNECQKAFNT 344
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
516-540 5.25e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  516 LIIHQRTHTGEKPFECSECQKAFNT 540
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
768-792 6.21e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 6.21e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  768 LLVHQRMHTREKPYECSECGKAFIR 792
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
264-288 6.95e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.45  E-value: 6.95e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  264 LVIHQRIHTGENPYECCECGKVFSR 288
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
414-827 1.06e-16

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 82.44  E-value: 1.06e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 414 MKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECN--NCGKAFSFKSQLIIHQRIHTGENPYECheCGKAFSRKYQLISH 491
Cdd:COG5048   31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDLN--SKSLPLSNSKASSS 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 492 QRTHAGEKPYECTDCgkAFGLKSQLIIHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTgEKPYSCNECGKAFTFKSQ 571
Cdd:COG5048  109 SLSSSSSNSNDNNLL--SSHSLPPSSRDPQLPDLLSISNLRNNPLPGNNSSSVNTPQSNSL-HPPLPANSLSKDPSSNLS 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 572 LIVHKGVHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:COG5048  186 LLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSL 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 652 FNSQLIVHQRIHTGE-------NPYECSECGKAFNRKDQLISHQRT--HAGE--KPYGCSE--CGKAFSSKSYLIIHMRT 718
Cdd:COG5048  266 PTASSQSSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILL 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 719 HSGEKPYECNEC-------GKAFIWKSLLIVHERTHAGVNPYKC--SQCEKSFSGKLRLLVHQRMHTREKPYEC--SECG 787
Cdd:COG5048  346 HTSISPAKEKLLnssskfsPLLNNEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCknPPCS 425
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
gi 259490323 788 KAFIRNSQLIVHQRTHSgEKPYGCNECGKTFSQKSILSAH 827
Cdd:COG5048  426 KSFNRHYNLIPHKKIHT-NHAPLLCSILKSFRRDLDLSNH 464
 
Name Accession Description Interval E-value
KRAB_A-box cd07765
KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression ...
2-37 4.55e-16

KRAB (Kruppel-associated box) domain -A box; The KRAB domain is a transcription repression module, found in a subgroup of the zinc finger proteins (ZFPs) of the C2H2 family, KRAB-ZFPs. KRAB-ZFPs comprise the largest group of transcriptional regulators in mammals, and are only found in tetrapods. These proteins have been shown to play important roles in cell differentiation and organ development, and in regulating viral replication and transcription. A KRAB domain may consist of an A-box, or of an A-box plus either a B-box, a divergent B-box (b), or a C-box. Only the A-box is included in this model. The A-box is needed for repression, the B- and C- boxes are not. KRAB-ZFPs have one or two KRAB domains at their amino-terminal end, and multiple C2H2 zinc finger motifs at their C-termini. Some KRAB-ZFPs also contain a SCAN domain which mediates homo- and hetero-oligomerization. The KRAB domain is a protein-protein interaction module which represses transcription through recruiting corepressors. A key mechanism appears to be the following: KRAB-AFPs tethered to DNA recruit, via their KRAB domain, the repressor KAP1 (KRAB-associated protein-1, also known as transcription intermediary factor 1 beta , KRAB-A interacting protein , and tripartite motif protein 28). The KAP1/ KRAB-AFP complex in turn recruits the heterochromatin protein 1 (HP1) family, and other chromatin modulating proteins, leading to transcriptional repression through heterochromatin formation.


Pssm-ID: 143639  Cd Length: 40  Bit Score: 73.74  E-value: 4.55e-16
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 259490323   2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL 37
Cdd:cd07765    5 DVAVYFSQEEWELLDPAQRDLYRDVMLENYENLVSL 40
KRAB smart00349
krueppel associated box;
2-58 5.56e-30

krueppel associated box;


Pssm-ID: 214630  Cd Length: 61  Bit Score: 114.23  E-value: 5.56e-30
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 259490323     2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLGYQHTKPDIIFKLEQGEELCM 58
Cdd:smart00349   5 DVAVYFTQEEWEQLDPAQKNLYRDVMLENYSNLVSLGFQVPKPDLISQLEQGEEPWI 61
KRAB pfam01352
KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc ...
2-38 2.32e-20

KRAB box; The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.


Pssm-ID: 201743  Cd Length: 41  Bit Score: 86.07  E-value: 2.32e-20
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 259490323    2 DVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLG 38
Cdd:pfam01352   5 DVAVDFTQEEWGLLDPAQRNLYRDVMLENYSNLVSLG 41
zf-H2C2_2 pfam13465
Zinc-finger double domain;
627-651 4.90e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.91  E-value: 4.90e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  627 YLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
347-371 6.26e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 38.53  E-value: 6.26e-04
                          10        20
                  ....*....|....*....|....*
gi 259490323  347 NLMVHQRTHTGEKPYVCSDCGKAFT 371
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
711-734 1.33e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.76  E-value: 1.33e-03
                          10        20
                  ....*....|....*....|....
gi 259490323  711 YLIIHMRTHSGEKPYECNECGKAF 734
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
543-567 1.49e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 37.37  E-value: 1.49e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  543 NLIVHQRTHTGEKPYSCNECGKAFT 567
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
460-484 3.96e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 3.96e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  460 LIIHQRIHTGENPYECHECGKAFSR 484
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
656-680 4.47e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 4.47e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  656 LIVHQRIHTGENPYECSECGKAFNR 680
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
824-846 4.73e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 4.73e-03
                          10        20
                  ....*....|....*....|...
gi 259490323  824 LSAHQRTHTGEKPCKCTECGKAF 846
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSF 24
zf-H2C2_2 pfam13465
Zinc-finger double domain;
320-344 5.25e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  320 LIIHERIHTGEKPYECNECQKAFNT 344
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
516-540 5.25e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 5.25e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  516 LIIHQRTHTGEKPFECSECQKAFNT 540
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
768-792 6.21e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.83  E-value: 6.21e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  768 LLVHQRMHTREKPYECSECGKAFIR 792
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
264-288 6.95e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 35.45  E-value: 6.95e-03
                          10        20
                  ....*....|....*....|....*
gi 259490323  264 LVIHQRIHTGENPYECCECGKVFSR 288
Cdd:pfam13465   2 LRRHMRTHTGEKPYKCPECGKSFSS 26
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
414-827 1.06e-16

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 82.44  E-value: 1.06e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 414 MKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECN--NCGKAFSFKSQLIIHQRIHTGENPYECheCGKAFSRKYQLISH 491
Cdd:COG5048   31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDLN--SKSLPLSNSKASSS 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 492 QRTHAGEKPYECTDCgkAFGLKSQLIIHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTgEKPYSCNECGKAFTFKSQ 571
Cdd:COG5048  109 SLSSSSSNSNDNNLL--SSHSLPPSSRDPQLPDLLSISNLRNNPLPGNNSSSVNTPQSNSL-HPPLPANSLSKDPSSNLS 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 572 LIVHKGVHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECRECGKSFS 651
Cdd:COG5048  186 LLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSL 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 652 FNSQLIVHQRIHTGE-------NPYECSECGKAFNRKDQLISHQRT--HAGE--KPYGCSE--CGKAFSSKSYLIIHMRT 718
Cdd:COG5048  266 PTASSQSSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILL 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 719 HSGEKPYECNEC-------GKAFIWKSLLIVHERTHAGVNPYKC--SQCEKSFSGKLRLLVHQRMHTREKPYEC--SECG 787
Cdd:COG5048  346 HTSISPAKEKLLnssskfsPLLNNEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCknPPCS 425
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
gi 259490323 788 KAFIRNSQLIVHQRTHSgEKPYGCNECGKTFSQKSILSAH 827
Cdd:COG5048  426 KSFNRHYNLIPHKKIHT-NHAPLLCSILKSFRRDLDLSNH 464
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
302-687 2.67e-16

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 81.28  E-value: 2.67e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 302 QKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECN--ECQKAFNTKSNLMVHQRTHTGEKPYVCSD-CGKAFTFKSQLIV 378
Cdd:COG5048   31 PRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDLNSKsLPLSNSKASSSSL 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 379 HQGIHTGVKPYGCIQCGKGFSLKSQLIVHQRSHTGMKPYVCNECGKAFR----------------------SKSYLIIHT 436
Cdd:COG5048  111 SSSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPLPGNNSSSVntpqsnslhpplpanslskdpsSNLSLLISS 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 437 RTHTGEKLHECNNCGKAFSFKSQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQL 516
Cdd:COG5048  191 NVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSLPTASS 270
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 517 IIHQRTHTGE-------KPFECSECQKAFNTKSNLIVHQRT--HTGE--KPYSCNE--CGKAFTFKSQLIVHKGVHTGVK 583
Cdd:COG5048  271 QSSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILLHTSIS 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 584 PYGC--SQCAKTFS-----LKSQLIVHQRSHTGVKPYGC--SECGKAFRSKSYLIIHMRTHTGEKPHECR--ECGKSFSF 652
Cdd:COG5048  351 PAKEklLNSSSKFSpllnnEPPQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNR 430
                        410       420       430
                 ....*....|....*....|....*....|....*
gi 259490323 653 NSQLIVHQRIHTGENPYECSECGKaFNRKDQLISH 687
Cdd:COG5048  431 HYNLIPHKKIHTNHAPLLCSILKS-FRRDLDLSNH 464
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
331-732 6.37e-16

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 80.12  E-value: 6.37e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 331 KPYECNECQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFK--SQLIVHQGIHTGVKPY-GCIQCGKGFSLKSQLIVH 407
Cdd:COG5048   32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSrpLELSRHLRTHHNNPSDlNSKSLPLSNSKASSSSLS 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 408 QRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHT---GEKLHECNNCGKAFSfKSQLIIHQRIHTgenpyecHECGKAFSR 484
Cdd:COG5048  112 SSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISnlrNNPLPGNNSSSVNTP-QSNSLHPPLPAN-------SLSKDPSSN 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 485 KYQLISHQRTHAGEKPYECTDCGKAFGLKSQLIIHQRTHTgEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGK 564
Cdd:COG5048  184 LSLLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENS-SSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPR 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 565 AFTFKSQLIVHKGVHTGV-------KPYGCSQCAKTFSLKSQLIVHQRS--HTG--VKPYGCSE--CGKAFRSKSYLIIH 631
Cdd:COG5048  263 SSLPTASSQSSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGesLKPFSCPYslCGKLFSRNDALKRH 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 632 MRTHTGEKPHECRECGKSFSFNS-------QLIVHQRIHTGENPYEC--SECGKAFNRKDQLISHQRTHAGEKPYGC--S 700
Cdd:COG5048  343 ILLHTSISPAKEKLLNSSSKFSPllnneppQSLQQYKDLKNDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCknP 422
                        410       420       430
                 ....*....|....*....|....*....|..
gi 259490323 701 ECGKAFSSKSYLIIHMRTHSGEKPYECNECGK 732
Cdd:COG5048  423 PCSKSFNRHYNLIPHKKIHTNHAPLLCSILKS 454
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
471-832 8.27e-14

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 73.19  E-value: 8.27e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 471 NPYECHECGKAFSRKYQLISHQRTHAGEKPYECTD--CGKAFGLKSQLIIHQRTHTGEKPFECS--ECQKAFNTKSNLIV 546
Cdd:COG5048   32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYsgCDKSFSRPLELSRHLRTHHNNPSDLNSksLPLSNSKASSSSLS 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 547 HQRTHT--GEKPYSCNECGKAFTFKSQLIVHKGVHTGVKPYGC----SQCAKTFSLKSQLIV---------------HQR 605
Cdd:COG5048  112 SSSSNSndNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPLPGNnsssVNTPQSNSLHPPLPAnslskdpssnlslliSSN 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 606 SHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLI 685
Cdd:COG5048  192 VSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSLPTASSQ 271
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 686 SHQRTHAGE-------KPYGCSECGKAFSSKSYLIIHMRT--HSGE--KPYECNE--CGKAFIWKSLLIVHERTHAGVNP 752
Cdd:COG5048  272 SSSPNESDSssekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILLHTSISP 351
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 753 YKC--SQCEKSFSGKLRLLVHQRMHTR-----EKPYEC--SECGKAFIRNSQLIVHQRTHSGEKPYGCN--ECGKTFSQK 821
Cdd:COG5048  352 AKEklLNSSSKFSPLLNNEPPQSLQQYkdlknDKKSETlsNSCIRNFKRDSNLSLHIITHLSFRPYNCKnpPCSKSFNRH 431
                        410
                 ....*....|.
gi 259490323 822 SILSAHQRTHT 832
Cdd:COG5048  432 YNLIPHKKIHT 442
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
611-864 1.68e-08

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 56.63  E-value: 1.68e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 611 KPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECR--ECGKSFSFNSQLIVHQRIHTGENPYECSECG---KAFNRKDQLI 685
Cdd:COG5048   32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDLNSKSLplsNSKASSSSLS 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 686 SHqrTHAGEKPYGCSECGKAFSSKSYLIIHMR--THSGEKPYE---------------------CNECGKAFIWKSLLIV 742
Cdd:COG5048  112 SS--SSNSNDNNLLSSHSLPPSSRDPQLPDLLsiSNLRNNPLPgnnsssvntpqsnslhpplpaNSLSKDPSSNLSLLIS 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 743 HERTHAGVNPYKCSQCEkSFSGKLRLLVHQRMHTREKPYECSECGKAF------------------------------IR 792
Cdd:COG5048  190 SNVSTSIPSSSENSPLS-SSYSIPSSSSDQNLENSSSSLPLTTNSQLSpksllsqspsslsssdssssasesprsslpTA 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 793 NSQLIVHQRTHSGE-----KPYGCNECGKTFSQKSILSAHQRT--HTGE--KPCKCTE--CGKAFCWKSQLIMHQRTHVD 861
Cdd:COG5048  269 SSQSSSPNESDSSSekgfsLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYslCGKLFSRNDALKRHILLHTS 348

                 ...
gi 259490323 862 DKH 864
Cdd:COG5048  349 ISP 351
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
499-839 1.77e-08

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 56.24  E-value: 1.77e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 499 KPYECTDCGKAFGLKSQLIIHQRTHTGEKPFECS--ECQKAFNTKSNLIVHQRTHTGEKPY-SCNECGKAFTFKSQLIVH 575
Cdd:COG5048   32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSysGCDKSFSRPLELSRHLRTHHNNPSDlNSKSLPLSNSKASSSSLS 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 576 KGVHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSEC-GKAFRSKSYLIIHMRTHTGEKPHEcrecgkSFSFNS 654
Cdd:COG5048  112 SSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPLPGNnSSSVNTPQSNSLHPPLPANSLSKD------PSSNLS 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 655 QLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAgEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAF 734
Cdd:COG5048  186 LLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENS-SSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSS 264
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 259490323 735 IWKSLLIVHERTHagvnpyKCSQCEKSFSgklrllvhqrmhtreKPYECSECGKAFIRNSQLIVHQRT--HSGE--KPYG 810
Cdd:COG5048  265 LPTASSQSSSPNE------SDSSSEKGFS---------------LPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFS 323
                        330       340       350
                 ....*....|....*....|....*....|.
gi 259490323 811 CNE--CGKTFSQKSILSAHQRTHTGEKPCKC 839
Cdd:COG5048  324 CPYslCGKLFSRNDALKRHILLHTSISPAKE 354
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH