NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|146231948|ref|NP_001078937.1|]
View 

catenin delta-1 isoform 3A

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
262-380 1.91e-25

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


:

Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 102.78  E-value: 1.91e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 262 WRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDqD 341
Cdd:cd00020    4 IQAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRNLAAGPE-D 82
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 146231948 342 NKIAIKNCDGVPALVRLLRKARDmDLTEVITGTLWNLSS 380
Cdd:cd00020   83 NKLIVLEAGGVPKLVNLLDSSNE-DIQKNATGALSNLAS 120
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
550-652 3.14e-14

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


:

Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 70.42  E-value: 3.14e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 550 ELLFQPEVVRIYISLLKESkTPAILEASAGAIQNLCAGrwtyGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRN 629
Cdd:cd00020    1 EAVIQAGGLPALVSLLSSS-DENVQREAAWALSNLSAG----NNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRN 75
                         90       100
                 ....*....|....*....|....*
gi 146231948 630 LAVDARNK--ELIGKHAIPNLVKNL 652
Cdd:cd00020   76 LAAGPEDNklIVLEAGGVPKLVNLL 100
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
423-487 1.56e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


:

Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.06  E-value: 1.56e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146231948 423 ESVLTNTAGCLRNVSSERSEARRKLRECDG---LVDALifivqaeigqKDSDSKLVENCVCLLRNLSY 487
Cdd:cd00020   21 ENVQREAAWALSNLSAGNNDNIQAVVEAGGlpaLVQLL----------KSEDEEVVKAALWALRNLAA 78
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
262-380 1.91e-25

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 102.78  E-value: 1.91e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 262 WRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDqD 341
Cdd:cd00020    4 IQAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRNLAAGPE-D 82
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 146231948 342 NKIAIKNCDGVPALVRLLRKARDmDLTEVITGTLWNLSS 380
Cdd:cd00020   83 NKLIVLEAGGVPKLVNLLDSSNE-DIQKNATGALSNLAS 120
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
550-652 3.14e-14

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 70.42  E-value: 3.14e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 550 ELLFQPEVVRIYISLLKESkTPAILEASAGAIQNLCAGrwtyGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRN 629
Cdd:cd00020    1 EAVIQAGGLPALVSLLSSS-DENVQREAAWALSNLSAG----NNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRN 75
                         90       100
                 ....*....|....*....|....*
gi 146231948 630 LAVDARNK--ELIGKHAIPNLVKNL 652
Cdd:cd00020   76 LAAGPEDNklIVLEAGGVPKLVNLL 100
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
423-487 1.56e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.06  E-value: 1.56e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146231948 423 ESVLTNTAGCLRNVSSERSEARRKLRECDG---LVDALifivqaeigqKDSDSKLVENCVCLLRNLSY 487
Cdd:cd00020   21 ENVQREAAWALSNLSAGNNDNIQAVVEAGGlpaLVQLL----------KSEDEEVVKAALWALRNLAA 78
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
339-380 2.26e-06

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 45.88  E-value: 2.26e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 146231948   339 DQDNKIAIKNCDGVPALVRLLRKaRDMDLTEVITGTLWNLSS 380
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKS-EDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
339-380 8.58e-06

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 249922  Cd Length: 41  Bit Score: 43.97  E-value: 8.58e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 146231948  339 DQDNKIAIKNCDGVPALVRLLRKaRDMDLTEVITGTLWNLSS 380
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVQLLSS-PDEEVQEEAAWALSNLAA 41
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
596-631 4.05e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 42.03  E-value: 4.05e-05
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 146231948   596 RSALRQEKALSAIADLLTNEHERVVKAASGALRNLA 631
Cdd:smart00185   5 KQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLS 40
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
596-631 1.82e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 249922  Cd Length: 41  Bit Score: 40.12  E-value: 1.82e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 146231948  596 RSALRQEKALSAIADLLTNEHERVVKAASGALRNLA 631
Cdd:pfam00514   5 KQAVIEAGAVPPLVQLLSSPDEEVQEEAAWALSNLA 40
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
262-380 1.91e-25

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 102.78  E-value: 1.91e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 262 WRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDqD 341
Cdd:cd00020    4 IQAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRNLAAGPE-D 82
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 146231948 342 NKIAIKNCDGVPALVRLLRKARDmDLTEVITGTLWNLSS 380
Cdd:cd00020   83 NKLIVLEAGGVPKLVNLLDSSNE-DIQKNATGALSNLAS 120
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
550-652 3.14e-14

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 70.42  E-value: 3.14e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 550 ELLFQPEVVRIYISLLKESkTPAILEASAGAIQNLCAGrwtyGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRN 629
Cdd:cd00020    1 EAVIQAGGLPALVSLLSSS-DENVQREAAWALSNLSAG----NNDNIQAVVEAGGLPALVQLLKSEDEEVVKAALWALRN 75
                         90       100
                 ....*....|....*....|....*
gi 146231948 630 LAVDARNK--ELIGKHAIPNLVKNL 652
Cdd:cd00020   76 LAAGPEDNklIVLEAGGVPKLVNLL 100
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
423-487 1.56e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.06  E-value: 1.56e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 146231948 423 ESVLTNTAGCLRNVSSERSEARRKLRECDG---LVDALifivqaeigqKDSDSKLVENCVCLLRNLSY 487
Cdd:cd00020   21 ENVQREAAWALSNLSAGNNDNIQAVVEAGGlpaLVQLL----------KSEDEEVVKAALWALRNLAA 78
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
302-438 7.27e-14

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 69.27  E-value: 7.27e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 302 DVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGrDQDNKIAIKNCDGVPALVRLLrKARDMDLTEVITGTLWNLSSH 381
Cdd:cd00020    2 AVIQAGGLPALVSLLSSSDENVQREAAWALSNLSAG-NNDNIQAVVEAGGLPALVQLL-KSEDEEVVKAALWALRNLAAG 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 146231948 382 DSIKMEIVDHALhALTDEVIIPHSgwerePNEDckprhiewesVLTNTAGCLRNVSS 438
Cdd:cd00020   80 PEDNKLIVLEAG-GVPKLVNLLDS-----SNED----------IQKNATGALSNLAS 120
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
339-380 2.26e-06

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 45.88  E-value: 2.26e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 146231948   339 DQDNKIAIKNCDGVPALVRLLRKaRDMDLTEVITGTLWNLSS 380
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKS-EDEEVVKEAAWALSNLSS 41
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
296-336 5.36e-06

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 44.73  E-value: 5.36e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 146231948   296 NDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISF 336
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
339-380 8.58e-06

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 249922  Cd Length: 41  Bit Score: 43.97  E-value: 8.58e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 146231948  339 DQDNKIAIKNCDGVPALVRLLRKaRDMDLTEVITGTLWNLSS 380
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVQLLSS-PDEEVQEEAAWALSNLAA 41
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
596-631 4.05e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 42.03  E-value: 4.05e-05
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 146231948   596 RSALRQEKALSAIADLLTNEHERVVKAASGALRNLA 631
Cdd:smart00185   5 KQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLS 40
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
296-335 6.17e-05

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 249922  Cd Length: 41  Bit Score: 41.66  E-value: 6.17e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 146231948  296 NDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNIS 335
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVQLLSSPDEEVQEEAAWALSNLA 40
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
596-631 1.82e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 249922  Cd Length: 41  Bit Score: 40.12  E-value: 1.82e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 146231948  596 RSALRQEKALSAIADLLTNEHERVVKAASGALRNLA 631
Cdd:pfam00514   5 KQAVIEAGAVPPLVQLLSSPDEEVQEEAAWALSNLA 40
Syo1_like cd13394
Fungal symportin 1 (syo1) and similar proteins; This family of eukaryotic proteins includes ...
565-633 7.11e-03

Fungal symportin 1 (syo1) and similar proteins; This family of eukaryotic proteins includes Saccharomyces cerevisiae Ydl063c and Chaetomium thermophilum Syo1, which mediate the co-import of two ribosomal proteins, Rpl5 and Rpl11 (which both interact with 5S rRNA) into the nucleus. Import precedes their association with rRNA and subsequent ribosome assembly in the nucleolus. The primary structure of syo1 is a mixture of Armadillo- (ARM, N-terminal part of syo1) and HEAT-repeats (C-terminal part of syo1).


Pssm-ID: 240521 [Multi-domain]  Cd Length: 597  Bit Score: 38.44  E-value: 7.11e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146231948 565 LKESKTPAILE-----------ASAGAIQNLCagrwtYGRYIRSALRQEKALSAIAD-LLTNEHERVVKAASGALRNLAV 632
Cdd:cd13394   34 LREKKILPLLEklqspsandrsMALGAISNLI-----EDPSMRKLLLKEKLVQILIErLLDDSNTEVVVEAFGALRNLAI 108

                 .
gi 146231948 633 D 633
Cdd:cd13394  109 E 109
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH