NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110224452|ref|NP_001035959.1|]
View 

solute carrier family 12 member 6 isoform c [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SLC12 super family cl07850
Solute carrier family 12;
715-1091 3.50e-42

Solute carrier family 12;


The actual alignment was detected with superfamily member pfam03522:

Pssm-ID: 281515  Cd Length: 353  Bit Score: 158.85  E-value: 3.50e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   715 PRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAaeQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKH 794
Cdd:pfam03522    2 PALVDFAHLITKNNSLMICGHVVPGRLSQKLRSELQ--KKAYKWLRKRKIKAFYSLVDGDNLREGAQALLQASGLGKLKP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   795 NTVVMGWPNGWRQSE------------DA-------------------RAWKTFIGTVRVTTAAHLALLVAKNISFFPSN 843
Cdd:pfam03522   80 NILLMGYKSDWRTCSkeeleeyfniihDAfdlryavailrlpegldisMKKSEKSDKLNKKDRSISYRTASGSEKEILNQ 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   844 VEQF----SEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIE-AEVEVVe 918
Cdd:pfam03522  160 ITQFqkkqKKGTIDVWWLYDDGGLTLLLPYILSTRKNWSDCKLRVFALANRKDELEEEQRNMASLLSKFRIDySDLTVI- 238
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   919 mhdSDISAYTYERTLMMEQrsQMLRHMRLSKTERDREAQlvkdrnsmLRLTsigsdeDEETETYQEKVHmtwtkdkymas 998
Cdd:pfam03522  239 ---PDITKKPKEETKKFFD--ELIEPFRLNEDSKEEESA--------WKIT------DSELEALREKTN----------- 288
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   999 rgqkaksmegfqdllnmrpdqsnvrRMhtaVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLL 1078
Cdd:pfam03522  289 -------------------------RQ---LRLRELLLEHSSDANLIVMTLPMPRKGAVSAPLYMAWLEMLTRDLPPFLL 340
                          410
                   ....*....|...
gi 110224452  1079 VRGGGSEVITIYS 1091
Cdd:pfam03522  341 VRGNQTSVLTFYS 353
SLC5-6-like_sbd super family cl00456
Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the ...
150-301 1.64e-03

Solute carrier families 5 and 6-like; solute binding domain; This superfamily includes the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporters or solute sodium symporters), SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporters or Na+/Cl--dependent transporters), and nucleobase-cation-symport-1 (NCS1) transporters. SLC5s co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. SLC6s include Na+/Cl--dependent plasma membrane transporters for the monoamine neurotransmitters serotonin, dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. Members of this superfamily are important in human physiology and disease. They contain a functional core of 10 transmembrane helices (TMs): an inverted structural repeat, TMs1-5 and TMs6-10; TMs numbered to conform to the SLC6 Aquifex aeolicus LeuT.


The actual alignment was detected with superfamily member COG1953:

Pssm-ID: 294310  Cd Length: 497  Bit Score: 40.73  E-value: 1.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  150 TWVVGTAGV------LQAFAIVLICCCctmLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVGL-------CFYLG 216
Cdd:COG1953    59 TYMLAAGLFelglspWQALLAILVGNL---IVAIFMVLNGHAGSK-YGIPFPVLSRASFGIYGANFPAliraivaIVWYG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  217 T-TFAAAmyilGAIEIFLVyivpraAIFHSDDALKESAAMLNnMRVYGTA----FLVLMVLVVFIGVRYVNKFASL--FL 289
Cdd:COG1953   135 VqTYAGG----LAVNLLLG------SIFPSLLIPNTLSPLLG-LTTLELIcffiFWVLQLLVLFKGMESIRKFETWagPL 203
                         170
                  ....*....|..
gi 110224452  290 ACVIVSILAIYA 301
Cdd:COG1953   204 VYIAMLGLAIWA 215
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


:

Pssm-ID: 273347 [Multi-domain]  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
 
Name Accession Description Interval E-value
SLC12 pfam03522
Solute carrier family 12;
715-1091 3.50e-42

Solute carrier family 12;


Pssm-ID: 281515  Cd Length: 353  Bit Score: 158.85  E-value: 3.50e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   715 PRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAaeQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKH 794
Cdd:pfam03522    2 PALVDFAHLITKNNSLMICGHVVPGRLSQKLRSELQ--KKAYKWLRKRKIKAFYSLVDGDNLREGAQALLQASGLGKLKP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   795 NTVVMGWPNGWRQSE------------DA-------------------RAWKTFIGTVRVTTAAHLALLVAKNISFFPSN 843
Cdd:pfam03522   80 NILLMGYKSDWRTCSkeeleeyfniihDAfdlryavailrlpegldisMKKSEKSDKLNKKDRSISYRTASGSEKEILNQ 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   844 VEQF----SEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIE-AEVEVVe 918
Cdd:pfam03522  160 ITQFqkkqKKGTIDVWWLYDDGGLTLLLPYILSTRKNWSDCKLRVFALANRKDELEEEQRNMASLLSKFRIDySDLTVI- 238
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   919 mhdSDISAYTYERTLMMEQrsQMLRHMRLSKTERDREAQlvkdrnsmLRLTsigsdeDEETETYQEKVHmtwtkdkymas 998
Cdd:pfam03522  239 ---PDITKKPKEETKKFFD--ELIEPFRLNEDSKEEESA--------WKIT------DSELEALREKTN----------- 288
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   999 rgqkaksmegfqdllnmrpdqsnvrRMhtaVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLL 1078
Cdd:pfam03522  289 -------------------------RQ---LRLRELLLEHSSDANLIVMTLPMPRKGAVSAPLYMAWLEMLTRDLPPFLL 340
                          410
                   ....*....|...
gi 110224452  1079 VRGGGSEVITIYS 1091
Cdd:pfam03522  341 VRGNQTSVLTFYS 353
FUI1 COG1953
Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme ...
150-301 1.64e-03

Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme transport and metabolism];


Pssm-ID: 224864  Cd Length: 497  Bit Score: 40.73  E-value: 1.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  150 TWVVGTAGV------LQAFAIVLICCCctmLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVGL-------CFYLG 216
Cdd:COG1953    59 TYMLAAGLFelglspWQALLAILVGNL---IVAIFMVLNGHAGSK-YGIPFPVLSRASFGIYGANFPAliraivaIVWYG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  217 T-TFAAAmyilGAIEIFLVyivpraAIFHSDDALKESAAMLNnMRVYGTA----FLVLMVLVVFIGVRYVNKFASL--FL 289
Cdd:COG1953   135 VqTYAGG----LAVNLLLG------SIFPSLLIPNTLSPLLG-LTTLELIcffiFWVLQLLVLFKGMESIRKFETWagPL 203
                         170
                  ....*....|..
gi 110224452  290 ACVIVSILAIYA 301
Cdd:COG1953   204 VYIAMLGLAIWA 215
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


Pssm-ID: 273347 [Multi-domain]  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
AA_permease pfam00324
Amino acid permease;
131-701 2.90e-48

Amino acid permease;


Pssm-ID: 278739 [Multi-domain]  Cd Length: 467  Bit Score: 179.82  E-value: 2.90e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   131 GVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVG 210
Cdd:pfam00324    1 HVQMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLSLGEISTNGPV-SGGFYTYASRFLGPSLGFATG 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   211 L--CFYLGTTFAAAmyiLGAIEIFLVYIVPRAAIfhsddalkesaamlNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:pfam00324   80 WnyWLSWITVLALE---LTAASILIQFWELVPDI--------------PYLWVWGAVFLVLLTIINLVGVKWYGEAEFWF 142
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAI--KSSFAPPHFPVcmlgnrtlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdEYFV 366
Cdd:pfam00324  143 ALIKIIAIIGFIIVGIilLSGGNPNDGAI-----------------------------------------------FRYL 175
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   367 HNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheYVLVdittsftllvgIFFPSVTGIMAGSNR 446
Cdd:pfam00324  176 GDNGGKNNFPPGFGGGFI--------------------------------SVFV-----------IAFFAFTGIELVGIA 212
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   447 SGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEG--VVLRDKFGDAVKGNLVVGTLSWPS--PWVIVIGSFFSTC 522
Cdd:pfam00324  213 AGEVKNPEKSIPKAILQVIWRITIFYILSLLAIGLLVPWndPGLLNDSASAASPFVIFFKFLGISglAPLINAVILTAAL 292
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   523 GAGLQSLTGAPRLLQAIAKDNIIPFlrVFGHSKANGEPTWALLLTAAIAELGILIASLdlVAPILSMFFLMCYLFVNLAC 602
Cdd:pfam00324  293 SAANSSLYSGSRMLYSLARDGLAPK--FLKKVDKRGVPLRAILVSMVISLLALLLASL--NPAIVFNFLLAISGLSGLIV 368
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   603 ALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFA 682
Cdd:pfam00324  369 WGLISLSHLRFRKAFKYQGRSIDELPFKAPLGPLGVILGLAAIIIILIIQFLYAFLPVPGGPKNWGAGSFAAAYLIVLLF 448
                          570
                   ....*....|....*....
gi 110224452   683 LLRLEEGPPHTKNWRPQLL 701
Cdd:pfam00324  449 LIILIGVKLHVKNWKPQLL 467
PotE COG0531
Amino acid transporter [Amino acid transport and metabolism];
113-668 1.48e-24

Amino acid transporter [Amino acid transport and metabolism];


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 107.17  E-value: 1.48e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  113 ITEGKKKPTKTPQMGTFMGVYLPCLQNIFGV-ILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNgvvpAG 191
Cdd:COG0531     1 SSNSMMSSELKKKLGLFDLLTALGVGSMIGSgIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSAIPS----AG 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  192 GSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIeIFLVYIVPRAAIFHSDDALKESAAmlnnmrvygtafLVLMV 271
Cdd:COG0531    77 GAYAYAKRALGPRLGFLAGWLYLLAYVIALAAIAIGAA-SYLSYLFPGPGLLSIGPLLIILIA------------LALIA 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  272 LVVFIGVRYVNKFASLFLACVIVSILAIYAGAIkssFAPPHFPvcmlgnrtlssrhidvcsktkeinnmtvpsklwgffc 351
Cdd:COG0531   144 LLTLLNLRGIKASAKINSIITILKIIILLIFII---LGLFAFG------------------------------------- 183
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  352 nssqffnatcdeyFVHNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVG 431
Cdd:COG0531   184 -------------FSNGNLFAPFNPGGGSFGGI-----------------------------------------LAAILL 209
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  432 IFFpSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSp 510
Cdd:COG0531   210 AFF-AFTGFEAIATLAEEVKNPKRTIPRAIILSLLIVLILYiLGALVIVGVLPAGDLAASAPSAPLALAALFGGGNWGA- 287
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  511 WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGH-SKANGEPTWALLLTAAIAELGILIASL-----DLVA 584
Cdd:COG0531   288 IIIAILALLSLFGSLLAWILAVSRVLYAMARDGLLP--KFFAKvNPKGRTPVIALILTGIISLILLLLFPLssiafNALV 365
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  585 PILSMFFLMCYLFVNLA---CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAI--VAMVIAGMIYKYIE 659
Cdd:COG0531   366 SLASVAFLIAYLLVALAllvLRRKKPDLKRPFRLPLAPLIPILGIVAVLLLLYALYASGLPPLLlgVILIAGGIIIYLLV 445

                  ....*....
gi 110224452  660 YQGAEKEWG 668
Cdd:COG0531   446 YLGLGRLLS 454
frlA PRK11357
putative fructoselysine transporter; Provisional
436-654 1.70e-04

putative fructoselysine transporter; Provisional


Pssm-ID: 183096 [Multi-domain]  Cd Length: 445  Bit Score: 44.08  E-value: 1.70e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFG--DAVKGNL---------VVGT 504
Cdd:PRK11357  207 SYTGMASICYMTGEIKNPGKTMPRALIGSCLLVLVLY----TLLALVISGLMPFDKLAnsETPISDAltwipalgsTAGI 282
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  505 LSWPSPWVIVIGSfFSTCgaglqsLTGAPRLLQAIAKDNIipFLRVFGHSKANGE-PTWALLLTAAIAELGILIASLdlv 583
Cdd:PRK11357  283 FVAITAMIVILGS-LSSC------VMYQPRLEYAMAKDNL--FFKCFGHVHPKYNtPDVSIILQGALGIFFIFVSDL--- 350
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  584 APILSMF-FLMCYLFVNLACALQTLLRTPNWRPRFRYYHWAL-SFMGMSICLALMFiSSWYYAIVAMVIAGMI 654
Cdd:PRK11357  351 TSLLGYFtLVMCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLmTTLAIASSLILVA-STFVWAPIPGLICAVI 422
 
Name Accession Description Interval E-value
SLC12 pfam03522
Solute carrier family 12;
715-1091 3.50e-42

Solute carrier family 12;


Pssm-ID: 281515  Cd Length: 353  Bit Score: 158.85  E-value: 3.50e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   715 PRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAaeQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKH 794
Cdd:pfam03522    2 PALVDFAHLITKNNSLMICGHVVPGRLSQKLRSELQ--KKAYKWLRKRKIKAFYSLVDGDNLREGAQALLQASGLGKLKP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   795 NTVVMGWPNGWRQSE------------DA-------------------RAWKTFIGTVRVTTAAHLALLVAKNISFFPSN 843
Cdd:pfam03522   80 NILLMGYKSDWRTCSkeeleeyfniihDAfdlryavailrlpegldisMKKSEKSDKLNKKDRSISYRTASGSEKEILNQ 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   844 VEQF----SEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIE-AEVEVVe 918
Cdd:pfam03522  160 ITQFqkkqKKGTIDVWWLYDDGGLTLLLPYILSTRKNWSDCKLRVFALANRKDELEEEQRNMASLLSKFRIDySDLTVI- 238
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   919 mhdSDISAYTYERTLMMEQrsQMLRHMRLSKTERDREAQlvkdrnsmLRLTsigsdeDEETETYQEKVHmtwtkdkymas 998
Cdd:pfam03522  239 ---PDITKKPKEETKKFFD--ELIEPFRLNEDSKEEESA--------WKIT------DSELEALREKTN----------- 288
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   999 rgqkaksmegfqdllnmrpdqsnvrRMhtaVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLL 1078
Cdd:pfam03522  289 -------------------------RQ---LRLRELLLEHSSDANLIVMTLPMPRKGAVSAPLYMAWLEMLTRDLPPFLL 340
                          410
                   ....*....|...
gi 110224452  1079 VRGGGSEVITIYS 1091
Cdd:pfam03522  341 VRGNQTSVLTFYS 353
FUI1 COG1953
Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme ...
150-301 1.64e-03

Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme transport and metabolism];


Pssm-ID: 224864  Cd Length: 497  Bit Score: 40.73  E-value: 1.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  150 TWVVGTAGV------LQAFAIVLICCCctmLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVGL-------CFYLG 216
Cdd:COG1953    59 TYMLAAGLFelglspWQALLAILVGNL---IVAIFMVLNGHAGSK-YGIPFPVLSRASFGIYGANFPAliraivaIVWYG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  217 T-TFAAAmyilGAIEIFLVyivpraAIFHSDDALKESAAMLNnMRVYGTA----FLVLMVLVVFIGVRYVNKFASL--FL 289
Cdd:COG1953   135 VqTYAGG----LAVNLLLG------SIFPSLLIPNTLSPLLG-LTTLELIcffiFWVLQLLVLFKGMESIRKFETWagPL 203
                         170
                  ....*....|..
gi 110224452  290 ACVIVSILAIYA 301
Cdd:COG1953   204 VYIAMLGLAIWA 215
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


Pssm-ID: 273347 [Multi-domain]  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
AA_permease pfam00324
Amino acid permease;
131-701 2.90e-48

Amino acid permease;


Pssm-ID: 278739 [Multi-domain]  Cd Length: 467  Bit Score: 179.82  E-value: 2.90e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   131 GVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVG 210
Cdd:pfam00324    1 HVQMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLSLGEISTNGPV-SGGFYTYASRFLGPSLGFATG 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   211 L--CFYLGTTFAAAmyiLGAIEIFLVYIVPRAAIfhsddalkesaamlNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:pfam00324   80 WnyWLSWITVLALE---LTAASILIQFWELVPDI--------------PYLWVWGAVFLVLLTIINLVGVKWYGEAEFWF 142
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAI--KSSFAPPHFPVcmlgnrtlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdEYFV 366
Cdd:pfam00324  143 ALIKIIAIIGFIIVGIilLSGGNPNDGAI-----------------------------------------------FRYL 175
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   367 HNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheYVLVdittsftllvgIFFPSVTGIMAGSNR 446
Cdd:pfam00324  176 GDNGGKNNFPPGFGGGFI--------------------------------SVFV-----------IAFFAFTGIELVGIA 212
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   447 SGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEG--VVLRDKFGDAVKGNLVVGTLSWPS--PWVIVIGSFFSTC 522
Cdd:pfam00324  213 AGEVKNPEKSIPKAILQVIWRITIFYILSLLAIGLLVPWndPGLLNDSASAASPFVIFFKFLGISglAPLINAVILTAAL 292
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   523 GAGLQSLTGAPRLLQAIAKDNIIPFlrVFGHSKANGEPTWALLLTAAIAELGILIASLdlVAPILSMFFLMCYLFVNLAC 602
Cdd:pfam00324  293 SAANSSLYSGSRMLYSLARDGLAPK--FLKKVDKRGVPLRAILVSMVISLLALLLASL--NPAIVFNFLLAISGLSGLIV 368
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   603 ALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFA 682
Cdd:pfam00324  369 WGLISLSHLRFRKAFKYQGRSIDELPFKAPLGPLGVILGLAAIIIILIIQFLYAFLPVPGGPKNWGAGSFAAAYLIVLLF 448
                          570
                   ....*....|....*....
gi 110224452   683 LLRLEEGPPHTKNWRPQLL 701
Cdd:pfam00324  449 LIILIGVKLHVKNWKPQLL 467
PotE COG0531
Amino acid transporter [Amino acid transport and metabolism];
113-668 1.48e-24

Amino acid transporter [Amino acid transport and metabolism];


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 107.17  E-value: 1.48e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  113 ITEGKKKPTKTPQMGTFMGVYLPCLQNIFGV-ILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNgvvpAG 191
Cdd:COG0531     1 SSNSMMSSELKKKLGLFDLLTALGVGSMIGSgIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSAIPS----AG 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  192 GSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIeIFLVYIVPRAAIFHSDDALKESAAmlnnmrvygtafLVLMV 271
Cdd:COG0531    77 GAYAYAKRALGPRLGFLAGWLYLLAYVIALAAIAIGAA-SYLSYLFPGPGLLSIGPLLIILIA------------LALIA 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  272 LVVFIGVRYVNKFASLFLACVIVSILAIYAGAIkssFAPPHFPvcmlgnrtlssrhidvcsktkeinnmtvpsklwgffc 351
Cdd:COG0531   144 LLTLLNLRGIKASAKINSIITILKIIILLIFII---LGLFAFG------------------------------------- 183
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  352 nssqffnatcdeyFVHNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVG 431
Cdd:COG0531   184 -------------FSNGNLFAPFNPGGGSFGGI-----------------------------------------LAAILL 209
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  432 IFFpSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSp 510
Cdd:COG0531   210 AFF-AFTGFEAIATLAEEVKNPKRTIPRAIILSLLIVLILYiLGALVIVGVLPAGDLAASAPSAPLALAALFGGGNWGA- 287
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  511 WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGH-SKANGEPTWALLLTAAIAELGILIASL-----DLVA 584
Cdd:COG0531   288 IIIAILALLSLFGSLLAWILAVSRVLYAMARDGLLP--KFFAKvNPKGRTPVIALILTGIISLILLLLFPLssiafNALV 365
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  585 PILSMFFLMCYLFVNLA---CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAI--VAMVIAGMIYKYIE 659
Cdd:COG0531   366 SLASVAFLIAYLLVALAllvLRRKKPDLKRPFRLPLAPLIPILGIVAVLLLLYALYASGLPPLLlgVILIAGGIIIYLLV 445

                  ....*....
gi 110224452  660 YQGAEKEWG 668
Cdd:COG0531   446 YLGLGRLLS 454
AA_permease_2 pfam13520
Amino acid permease;
414-658 1.24e-14

Amino acid permease;


Pssm-ID: 290254 [Multi-domain]  Cd Length: 421  Bit Score: 76.20  E-value: 1.24e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   414 NHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKdaQKSIPIGTILAILTTSFVY-LSNVVLFGAC-IEGVVLRD- 490
Cdd:pfam13520  178 EWTTFFPSGWPGVFLGFLGVLWSFTGFESAANVSEEVK--NKTVPKAIFIGVAIVGVLYlLVNIAFLGVVpDDEIANLSn 255
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   491 --KFGDAVKGNLVVGTLSWpspwVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTA 568
Cdd:pfam13520  256 vlSVAALLFQAVGGSWGAI----IVVILLALSLFGAVNTAVVGSSRLLYALARDGVLP--RFFAKVNKFGSPIRAIILTA 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   569 AIAELGILIASLDLVAPI-LSMFFLMCYLFVNLACALqtLLRTPNWRPRfRYYHWALSFMGMsICLALMFISSWYYAIVA 647
Cdd:pfam13520  330 ILSLILSLLFLLGYNALLsLSAYGYLLVYLLLIIGLL--ILRKKRPDLP-RPGRIPVAILGI-LFSLFLLVALFFPPKGP 405
                          250
                   ....*....|.
gi 110224452   648 MVIAGMIYKYI 658
Cdd:pfam13520  406 ATGSSLNYAII 416
2A0306 TIGR00909
amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]
431-655 2.62e-08

amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 129987 [Multi-domain]  Cd Length: 429  Bit Score: 56.30  E-value: 2.62e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   431 GIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFGDaVKGNLVVGTLSWPSP 510
Cdd:TIGR00909  202 ALVFFAFIGFEAISTAAEEVKNPERDIPKAIILSLIVVTLLY----VLVAAVILGAVPWRQLAG-STAPLSLVGYDLGQG 276
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   511 ---WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIP--FLRVfgHSKaNGEPTWALLLTAAIAELGILIASLDLVAP 585
Cdd:TIGR00909  277 iggLILTAGAVFSIASVMLAGIYGTSRVLFAMSRDGLLPgsLSKV--HPK-TGTPHMSIIIFSLTAALLASLVPLEGLAE 353
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 110224452   586 ILSMFFLMCYLFVNLACALQTlLRTPNWRPRFRY-YHWALSFMGMSICLALMF---ISSWYYAIVAMVIAGMIY 655
Cdd:TIGR00909  354 LTSIGTLIAFAAVNVAVIILR-RRRPDIQRAFRCpLVPVLPVLVVSYCIYLLLnlgPGTTVWFLVWMLLGSVFY 426
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
448-647 2.31e-05

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273332 [Multi-domain]  Cd Length: 501  Bit Score: 46.66  E-value: 2.31e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   448 GDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPwvIVIGsfFSTCGAGL 526
Cdd:TIGR00911  259 EEVKNPYRTLPIAIIISMPIVTFIYvLTNIAYFTVLSPEELLASLAVAVDFGERLLGVMSWAMP--ALVG--LSCFGSVN 334
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   527 QSLTGAPRLLQAIAKDNIIPFLRVFGHSKANgEPTWALLLTAAIAELGILIASLDLVAPILSMFFlmcYLFVNLACALQT 606
Cdd:TIGR00911  335 GSLFSSSRLFFVGGREGHLPSLLSMIHVKRL-TPLPSLLIVCTLTLLMLFSGDIYSLINLISFAN---WLFNALAVAGLL 410
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 110224452   607 LLR--TPNWRPRFRyyhwalsfmgMSICLALMFISSWYYAIVA 647
Cdd:TIGR00911  411 WLRykRPEMNRPIK----------VPLFFPVFFLLSCLFLIIL 443
frlA PRK11357
putative fructoselysine transporter; Provisional
436-654 1.70e-04

putative fructoselysine transporter; Provisional


Pssm-ID: 183096 [Multi-domain]  Cd Length: 445  Bit Score: 44.08  E-value: 1.70e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFG--DAVKGNL---------VVGT 504
Cdd:PRK11357  207 SYTGMASICYMTGEIKNPGKTMPRALIGSCLLVLVLY----TLLALVISGLMPFDKLAnsETPISDAltwipalgsTAGI 282
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  505 LSWPSPWVIVIGSfFSTCgaglqsLTGAPRLLQAIAKDNIipFLRVFGHSKANGE-PTWALLLTAAIAELGILIASLdlv 583
Cdd:PRK11357  283 FVAITAMIVILGS-LSSC------VMYQPRLEYAMAKDNL--FFKCFGHVHPKYNtPDVSIILQGALGIFFIFVSDL--- 350
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  584 APILSMF-FLMCYLFVNLACALQTLLRTPNWRPRFRYYHWAL-SFMGMSICLALMFiSSWYYAIVAMVIAGMI 654
Cdd:PRK11357  351 TSLLGYFtLVMCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLmTTLAIASSLILVA-STFVWAPIPGLICAVI 422
2A0302 TIGR00905
transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several ...
420-650 7.33e-04

transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 129983 [Multi-domain]  Cd Length: 473  Bit Score: 41.97  E-value: 7.33e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   420 VDITTSFTLLVGIFFPSVTGIMA----------GSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFG--ACIEGV 486
Cdd:TIGR00905  184 ADFWGHDVPSLGSVFSQVKNTMLvtlwvfigieGAVVSSGRAKNKSDVGKATVLGTLGALVIYiLITLLSLGvlPQQELA 263
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   487 VLRDKFGDAVkGNLVVGTlsWPSPwVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLL 566
Cdd:TIGR00905  264 NLPNPSMAAV-LEMIVGK--WGAV-LISLGLIISVLGSLLSWTMLAAEVPFSAAKDGLFP--KIFGRVNKNGAPSVALLL 337
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   567 TAAIAELGILIASL-----DLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRyyHWALSFMGMSICLALMFISSW 641
Cdd:TIGR00905  338 TNILIQLFLLLTLLtssayNVLVSLAVVMILVPYLLSAAYLLKLAKVGTYPKIKNRK--ALIVGVIACVYSIWLLYAAGL 415

                   ....*....
gi 110224452   642 YYAIVAMVI 650
Cdd:TIGR00905  416 KYLLLGFIL 424
LysP COG0833
Amino acid permease [Amino acid transport and metabolism];
447-579 2.41e-03

Amino acid permease [Amino acid transport and metabolism];


Pssm-ID: 223903 [Multi-domain]  Cd Length: 541  Bit Score: 40.30  E-value: 2.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  447 SGDLKDAQKSIPI---GTILAILttsFVYLSNVVLFGACIegvvlrdKFGD-AVKGNLVVGTLSwpSPWVIVI------- 515
Cdd:COG0833   257 AGESENPRKSIPKaikQVFWRIL---LFYILSIFVIGLLV-------PYNDpRLLGNSSSGVAA--SPFVIAIknagipv 324
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 110224452  516 -GSFF------STCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTAAIAELGILIAS 579
Cdd:COG0833   325 aASIMnaviltSVLSAANSGLYASSRMLYSLAKQGKAP--KIFAKVDRRGVPLVALLVTLLFGLLAFLNSS 393
PRK10644 PRK10644
arginine:agmatin antiporter; Provisional
436-651 3.41e-03

arginine:agmatin antiporter; Provisional


Pssm-ID: 182613 [Multi-domain]  Cd Length: 445  Bit Score: 39.77  E-value: 3.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGAcIEGVVLR---DKFGDAVKgnLVVGTLSwpspw 511
Cdd:PRK10644  203 SFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYvLSSTAIMGM-IPNAALRvsaSPFGDAAR--MALGDTA----- 274
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  512 viviGSFFSTCGAG--LQSLTG----APRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTAAIAELgILIASL----- 580
Cdd:PRK10644  275 ----GAIVSFCAAAgcLGSLGGwtllAGQTAKAAADDGLFP--PIFARVNKAGTPVAGLLIVGVLMTI-FQLSSIspnas 347
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 110224452  581 ---DLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFryyhWALSFMGMSICLALMFISS-----WYYAIVAMVIA 651
Cdd:PRK10644  348 kefGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAY----LAVTLIAFVYCIWAVVGSGakevmWSFVTLMVITA 422
SdaC COG0814
Amino acid permease [Amino acid transport and metabolism];
144-300 6.20e-03

Amino acid permease [Amino acid transport and metabolism];


Pssm-ID: 223884 [Multi-domain]  Cd Length: 415  Bit Score: 38.79  E-value: 6.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  144 ILFLRLTwvVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAM 223
Cdd:COG0814    27 VLFLPVA--FGGGGFWPGLLLLIIAWPLTYLSLLLLLEALLSSPNGKASITSLVEDYLGKKGGILIGLSYFFALYGLLVA 104
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 110224452  224 YILGAIEIFLVYIvprAAIFHSDDALKesaamlnnmRVYGTAFLVLMVLVVFIGVRYVNKFASlFLACVIVSILAIY 300
Cdd:COG0814   105 YIVGIGNLLASFL---GNQFGLNPLPR---------KLGSLIFALVLAFLSWLGTLAVLKITS-LLVFGKVIYLVLL 168
arg_ornith_anti TIGR03810
arginine-ornithine antiporter; Members of this protein family are the arginine/ornithine ...
406-668 7.97e-03

arginine-ornithine antiporter; Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 163522 [Multi-domain]  Cd Length: 468  Bit Score: 38.49  E-value: 7.97e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   406 SSDVLGSLNHEYVLVDITTSF--TLLVGIF-FPSVTGIMAGSNRSGDLKDAQKSIPIGTI--LAILTtsfvyLSNVVLFG 480
Cdd:TIGR03810  177 TNDFWGNANGGFSLGSVMTQVknMMLVTVWvFIGIEGASMLSARAEKRSDVGKATVIGLIgvLAIYV-----LVSVLSYG 251
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   481 -------ACIE----GVVLRDKFGdavkgnlvvgtlSWpSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflR 549
Cdd:TIGR03810  252 imtqaqlAGLKnpsmAYVLEHMVG------------TW-GAVLINIGLIISILGAWLSWTLLPAEIPLLMAKDKLMP--K 316
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   550 VFGHSKANGEPTWALLLTAAIAELGILI------ASLDLVAPILSMfFLMCYLFVnlaCALQTLLRTPNWRPRFRYYHWA 623
Cdd:TIGR03810  317 YFGKENANGAPTNALWLTNGLIQIFLLTtlfseqAYNFAISLATSA-ILVPYLWS---AAYQVKLSWRGGQERGRRKQLL 392
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*..
gi 110224452   624 LSFMGMSICLALMFISSWYYAIVAMV--IAGMIYkyieYQGAEKEWG 668
Cdd:TIGR03810  393 IGLVALLYAVWLIYAAGLKYLLLSAIlyAPGIYF----YARARKEKG 435
2A0310 TIGR00913
amino acid permease (yeast); [Transport and binding proteins, Amino acids, peptides and amines]
447-601 8.12e-03

amino acid permease (yeast); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273334 [Multi-domain]  Cd Length: 478  Bit Score: 38.42  E-value: 8.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   447 SGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIegvvlrdKFGDAvkgNLVVGT---LSWPSPWVIVIGSF----- 518
Cdd:TIGR00913  220 AGEAANPRKSIPRAAKRTFWRILVFYILTLFLIGFLV-------PYNDP---RLLSSSsssDSAASPFVIAIQNHgikvl 289
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   519 ---------FSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTAAIAELGILIAS------LDLV 583
Cdd:TIGR00913  290 phifnavilISVLSAANSSLYASSRTLYALAHQGLAP--KIFAYVDRRGVPYVAVIVSSLFGLLAFLAVSkkeaevFTWL 367
                          170
                   ....*....|....*...
gi 110224452   584 APILSMFFLMCYLFVNLA 601
Cdd:TIGR00913  368 LNISGLSGFFTWMCICLS 385
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH