NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|108802617|ref|NP_001035822.1|]
View 

tyrosine-protein phosphatase non-receptor type 20 isoform 8

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTPc cd00047
Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; ...
104-330 5.86e-107

Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.


:

Pssm-ID: 238006 [Multi-domain]  Cd Length: 231  Bit Score: 314.91  E-value: 5.86e-107
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 104 EKNRYRDILPYDSTRVPLGKSK----DYINASYIRIVNCGEEYfyIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEG 179
Cdd:cd00047    1 KKNRYKDILPYDHTRVKLKPDDdegsDYINASYIDGYNPPKAY--IATQGPLPNTVEDFWRMVWEQKVPVIVMLTELVEK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 180 GIIKCYHYWPISLKkPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYA 259
Cdd:cd00047   79 GREKCAQYWPEEEG-SLTYGDITVTLVSEEKLDDYTVRTLKLSNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKV 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 108802617 260 RKSHL---TGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:cd00047  158 RKSQQqpgSGPIVVHCSAGVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYRAILE 231
PTPc smart00194
Protein tyrosine phosphatase, catalytic domain;
78-330 6.99e-111

Protein tyrosine phosphatase, catalytic domain;


:

Pssm-ID: 214550 [Multi-domain]  Cd Length: 259  Bit Score: 326.15  E-value: 6.99e-111
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617    78 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPL----GKSKDYINASYIRIVNCGEEYfyIATQGPLL 152
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLkpppGEGSDYINASYIDGPNGPKAY--IATQGPLP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   153 STIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSV 232
Cdd:smart00194  80 STVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPDEEGEPLTYGDITVTLKSVEKVDDYTIRTLEVTNTGCSETRTV 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   233 KQLQFTKWPDHGTPASADSFIKYIRYARK--SHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQ 310
Cdd:smart00194 160 THYHYTNWPDHGVPESPESILDLIRAVRKsqSTSTGPIVVHCSAGVGRTGTFIAIDILLQQLEAGKEVDIFEIVKELRSQ 239
                          250       260
                   ....*....|....*....|
gi 108802617   311 RSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00194 240 RPGMVQTEEQYIFLYRAILE 259
 
Name Accession Description Interval E-value
PTPc cd00047
Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; ...
104-330 5.86e-107

Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.


Pssm-ID: 238006 [Multi-domain]  Cd Length: 231  Bit Score: 314.91  E-value: 5.86e-107
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 104 EKNRYRDILPYDSTRVPLGKSK----DYINASYIRIVNCGEEYfyIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEG 179
Cdd:cd00047    1 KKNRYKDILPYDHTRVKLKPDDdegsDYINASYIDGYNPPKAY--IATQGPLPNTVEDFWRMVWEQKVPVIVMLTELVEK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 180 GIIKCYHYWPISLKkPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYA 259
Cdd:cd00047   79 GREKCAQYWPEEEG-SLTYGDITVTLVSEEKLDDYTVRTLKLSNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKV 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 108802617 260 RKSHL---TGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:cd00047  158 RKSQQqpgSGPIVVHCSAGVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYRAILE 231
PTPc_motif smart00404
Protein tyrosine phosphatase, catalytic domain motif;
231-330 1.32e-35

Protein tyrosine phosphatase, catalytic domain motif;


Pssm-ID: 214649  Cd Length: 105  Bit Score: 126.32  E-value: 1.32e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   231 SVKQLQFTKWPDHGTPASADSFIKYIRYARKSH----LTGPMVVHCSAGIGRTGVFLCVDVVfCAIVKNCS--FNIMDIV 304
Cdd:smart00404   1 TVKHYHYTGWPDHGVPESPDSILELLRAVKKNLnqseSSGPVVVHCSAGVGRTGTFVAIDIL-LQQLEAEAgeVDIFDTV 79
                           90       100
                   ....*....|....*....|....*.
gi 108802617   305 AQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00404  80 KELRSQRPGMVQTEEQYLFLYRALLE 105
PTZ00242 PTZ00242
protein tyrosine phosphatase; Provisional
234-323 5.07e-06

protein tyrosine phosphatase; Provisional


Pssm-ID: 185524  Cd Length: 166  Bit Score: 44.63  E-value: 5.07e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 234 QLQFTKWP--DHGTPASA--DSFIKYIR--YARKSHLTGPMVVHCSAGIGRTGVFLCVdvvfcAIVKNCSFNIMDIVAQM 307
Cdd:PTZ00242  61 GIEVHDWPfdDGAPPPKAviDNWLRLLDqeFAKQSTPPETIAVHCVAGLGRAPILVAL-----ALVEYGGMEPLDAVGFV 135
                         90
                 ....*....|....*.
gi 108802617 308 REQRSGMVQTKeQYHF 323
Cdd:PTZ00242 136 REKRKGAINQT-QLQF 150
PTPlike_phytase pfam14566
Inositol hexakisphosphate; Inositol hexakisphosphate, often called phytate, is found in ...
241-294 1.04e-03

Inositol hexakisphosphate; Inositol hexakisphosphate, often called phytate, is found in abundance in seeds and acting as an inorganic phosphate reservoir. Phytases are phosphatases that hydrolyze phytate to less-phosphorylated myo-inositol derivatives and inorganic phosphate. The active-site sequence (HCXXGXGR) of the phytase identified from the gut micro-organism Selenomonas ruminantium forms a loop (P loop) at the base of a substrate binding pocket that is characteristic of protein tyrosine phosphatases (PTPs). The depth of this pocket is an important determinant of the substrate specificity of PTPs. In humans this enzyme is thought to aid bone mineralization and salvage the inositol moiety prior to apoptosis.


Pssm-ID: 258704  Cd Length: 109  Bit Score: 36.78  E-value: 1.04e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 108802617  241 PDHGTPASA--DSFIKYIR-YARKSHLtgpmVVHCSAGIGRTGVFLcvdvVFCAIVK 294
Cdd:pfam14566  61 TDEKAPEEEdfDAFIEFVKsLPKDTAL----VFHCQAGRGRTTTFM----VIADLLR 109
PTPc smart00194
Protein tyrosine phosphatase, catalytic domain;
78-330 6.99e-111

Protein tyrosine phosphatase, catalytic domain;


Pssm-ID: 214550 [Multi-domain]  Cd Length: 259  Bit Score: 326.15  E-value: 6.99e-111
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617    78 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPL----GKSKDYINASYIRIVNCGEEYfyIATQGPLL 152
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLkpppGEGSDYINASYIDGPNGPKAY--IATQGPLP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   153 STIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSV 232
Cdd:smart00194  80 STVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPDEEGEPLTYGDITVTLKSVEKVDDYTIRTLEVTNTGCSETRTV 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   233 KQLQFTKWPDHGTPASADSFIKYIRYARK--SHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQ 310
Cdd:smart00194 160 THYHYTNWPDHGVPESPESILDLIRAVRKsqSTSTGPIVVHCSAGVGRTGTFIAIDILLQQLEAGKEVDIFEIVKELRSQ 239
                          250       260
                   ....*....|....*....|
gi 108802617   311 RSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00194 240 RPGMVQTEEQYIFLYRAILE 259
Y_phosphatase pfam00102
Protein-tyrosine phosphatase;
102-330 2.52e-104

Protein-tyrosine phosphatase;


Pssm-ID: 249588 [Multi-domain]  Cd Length: 232  Bit Score: 308.45  E-value: 2.52e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  102 NREKNRYRDILPYDSTRVPL--GKSKDYINASYIRIVNcgEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEG 179
Cdd:pfam00102   1 NLEKNRYKDVLPYDHTRVKLtpGGASDYINASYIDGYR--KPRAFIATQGPLPNTIEDFWRMVWEEKVTTIVMLTELEEK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  180 GIIKCYHYWPISLKKPLELKHFRVFLENYQ-ILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRY 258
Cdd:pfam00102  79 GREKCAQYWPEEEEGSLTYGDISVTLVKEEeEEDDYTVRTLELTNGGSEETRTVTHFHYTGWPDHGVPESPKSLLDLIRK 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 108802617  259 ARKSH--LTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:pfam00102 159 VRKSQdpDNGPIVVHCSAGVGRTGTFIALDILLQQLEAEGEVDIFQIVKELRSQRPGMVQTEEQYIFLYDAVLE 232
COG5599 COG5599
Protein tyrosine phosphatase [Signal transduction mechanisms];
100-336 2.46e-58

Protein tyrosine phosphatase [Signal transduction mechanisms];


Pssm-ID: 227886 [Multi-domain]  Cd Length: 302  Bit Score: 192.37  E-value: 2.46e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 100 PSNREKNRYRDILPYDSTRVPLGKSK---DYINASYIRIvncgEEYFYIATQGPLLSTIDDFWQMVLENNSN--VIAMIT 174
Cdd:COG5599   51 STNYARNRYSNIVPYEHTRVHLKYGKsinDYINASYIKT----PRGKYIATQGPKPETIDDFWKMVWHNVPNngVIVMLT 126
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 175 REIEGGIIKCYHYWPISL--KKPLELKHFRVFLENYQILQYFIIRMFQVvEKSTGTSHSVKQLQFTKWPDHGTPaSADSF 252
Cdd:COG5599  127 SLPEYNREKCDQYWPLGYddTLIIGLRVIKQKKYELFNDNIVNVHNFEL-TSINGPPKKIHHFQYINWVDFNVP-DIRSL 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 253 IKYIRYARKSHL-TGPMVVHCSAGIGRTGVFLCVDVVF---------CAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYH 322
Cdd:COG5599  205 TEVIHSLNDSPVrTGPIIVHCSAGVGRTGTFIALDILLrmpndtlnhTDTWEDTQDLIFQIVLSLRSQRMKMVQNKTQFK 284
                        250
                 ....*....|....
gi 108802617 323 FCYDIVLEVLRKLL 336
Cdd:COG5599  285 FLYDAFLELNKSQI 298
PHA02747 PHA02747
protein tyrosine phosphatase; Provisional
78-339 8.91e-47

protein tyrosine phosphatase; Provisional


Pssm-ID: 165114 [Multi-domain]  Cd Length: 312  Bit Score: 162.48  E-value: 8.91e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  78 IMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPL----GKSKDYINASYIRIVNcgEEYFYIATQGPLLS 153
Cdd:PHA02747  27 IRDEHHQIILKPFDGLIANFEKPENQPKNRYWDIPCWDHNRVILdsggGSTSDYIHANWIDGFE--DDKKFIATQGPFAE 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 154 TIDDFWQMVLENNSNVIAMIT-REIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSV 232
Cdd:PHA02747 105 TCADFWKAVWQEHCSIIVMLTpTKGTNGEEKCYQYWCLNEDGNIDMEDFRIETLKTSVRAKYILTLIEITDKILKDSRKI 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 233 KQLQFTKWPDHGTPASADSFIKYIR------------YARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNI 300
Cdd:PHA02747 185 SHFQCSEWFEDETPSDHPDFIKFIKiidinrkksgklFNPKDALLCPIVVHCSDGVGKTGIFCAVDICLNQLVKRKAICL 264
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 108802617 301 MDIVAQMREQRSGMVQTKEQYHF---CYDIVLEVLRKLLTLD 339
Cdd:PHA02747 265 AKTAEKIREQRHAGIMNFDDYLFiqpGYEVLHYFLSKIKAID 306
 
Name Accession Description Interval E-value
PTPc cd00047
Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; ...
104-330 5.86e-107

Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.


Pssm-ID: 238006 [Multi-domain]  Cd Length: 231  Bit Score: 314.91  E-value: 5.86e-107
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 104 EKNRYRDILPYDSTRVPLGKSK----DYINASYIRIVNCGEEYfyIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEG 179
Cdd:cd00047    1 KKNRYKDILPYDHTRVKLKPDDdegsDYINASYIDGYNPPKAY--IATQGPLPNTVEDFWRMVWEQKVPVIVMLTELVEK 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 180 GIIKCYHYWPISLKkPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYA 259
Cdd:cd00047   79 GREKCAQYWPEEEG-SLTYGDITVTLVSEEKLDDYTVRTLKLSNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKV 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 108802617 260 RKSHL---TGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:cd00047  158 RKSQQqpgSGPIVVHCSAGVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYRAILE 231
PTPc_motif smart00404
Protein tyrosine phosphatase, catalytic domain motif;
231-330 1.32e-35

Protein tyrosine phosphatase, catalytic domain motif;


Pssm-ID: 214649  Cd Length: 105  Bit Score: 126.32  E-value: 1.32e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   231 SVKQLQFTKWPDHGTPASADSFIKYIRYARKSH----LTGPMVVHCSAGIGRTGVFLCVDVVfCAIVKNCS--FNIMDIV 304
Cdd:smart00404   1 TVKHYHYTGWPDHGVPESPDSILELLRAVKKNLnqseSSGPVVVHCSAGVGRTGTFVAIDIL-LQQLEAEAgeVDIFDTV 79
                           90       100
                   ....*....|....*....|....*.
gi 108802617   305 AQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00404  80 KELRSQRPGMVQTEEQYLFLYRALLE 105
PTPc_DSPc smart00012
Protein tyrosine phosphatase, catalytic domain, undefined specificity; Protein tyrosine ...
231-330 1.32e-35

Protein tyrosine phosphatase, catalytic domain, undefined specificity; Protein tyrosine phosphatases. Homologues detected by this profile and not by those of "PTPc" or "DSPc" are predicted to be protein phosphatases with a similar fold to DSPs and PTPs, yet with unpredicted specificities.


Pssm-ID: 214469  Cd Length: 105  Bit Score: 126.32  E-value: 1.32e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   231 SVKQLQFTKWPDHGTPASADSFIKYIRYARKSH----LTGPMVVHCSAGIGRTGVFLCVDVVfCAIVKNCS--FNIMDIV 304
Cdd:smart00012   1 TVKHYHYTGWPDHGVPESPDSILELLRAVKKNLnqseSSGPVVVHCSAGVGRTGTFVAIDIL-LQQLEAEAgeVDIFDTV 79
                           90       100
                   ....*....|....*....|....*.
gi 108802617   305 AQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00012  80 KELRSQRPGMVQTEEQYLFLYRALLE 105
PTZ00242 PTZ00242
protein tyrosine phosphatase; Provisional
234-323 5.07e-06

protein tyrosine phosphatase; Provisional


Pssm-ID: 185524  Cd Length: 166  Bit Score: 44.63  E-value: 5.07e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 234 QLQFTKWP--DHGTPASA--DSFIKYIR--YARKSHLTGPMVVHCSAGIGRTGVFLCVdvvfcAIVKNCSFNIMDIVAQM 307
Cdd:PTZ00242  61 GIEVHDWPfdDGAPPPKAviDNWLRLLDqeFAKQSTPPETIAVHCVAGLGRAPILVAL-----ALVEYGGMEPLDAVGFV 135
                         90
                 ....*....|....*.
gi 108802617 308 REQRSGMVQTKeQYHF 323
Cdd:PTZ00242 136 REKRKGAINQT-QLQF 150
PTPlike_phytase pfam14566
Inositol hexakisphosphate; Inositol hexakisphosphate, often called phytate, is found in ...
241-294 1.04e-03

Inositol hexakisphosphate; Inositol hexakisphosphate, often called phytate, is found in abundance in seeds and acting as an inorganic phosphate reservoir. Phytases are phosphatases that hydrolyze phytate to less-phosphorylated myo-inositol derivatives and inorganic phosphate. The active-site sequence (HCXXGXGR) of the phytase identified from the gut micro-organism Selenomonas ruminantium forms a loop (P loop) at the base of a substrate binding pocket that is characteristic of protein tyrosine phosphatases (PTPs). The depth of this pocket is an important determinant of the substrate specificity of PTPs. In humans this enzyme is thought to aid bone mineralization and salvage the inositol moiety prior to apoptosis.


Pssm-ID: 258704  Cd Length: 109  Bit Score: 36.78  E-value: 1.04e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 108802617  241 PDHGTPASA--DSFIKYIR-YARKSHLtgpmVVHCSAGIGRTGVFLcvdvVFCAIVK 294
Cdd:pfam14566  61 TDEKAPEEEdfDAFIEFVKsLPKDTAL----VFHCQAGRGRTTTFM----VIADLLR 109
PTPc smart00194
Protein tyrosine phosphatase, catalytic domain;
78-330 6.99e-111

Protein tyrosine phosphatase, catalytic domain;


Pssm-ID: 214550 [Multi-domain]  Cd Length: 259  Bit Score: 326.15  E-value: 6.99e-111
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617    78 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPL----GKSKDYINASYIRIVNCGEEYfyIATQGPLL 152
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLkpppGEGSDYINASYIDGPNGPKAY--IATQGPLP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   153 STIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSV 232
Cdd:smart00194  80 STVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPDEEGEPLTYGDITVTLKSVEKVDDYTIRTLEVTNTGCSETRTV 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617   233 KQLQFTKWPDHGTPASADSFIKYIRYARK--SHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQ 310
Cdd:smart00194 160 THYHYTNWPDHGVPESPESILDLIRAVRKsqSTSTGPIVVHCSAGVGRTGTFIAIDILLQQLEAGKEVDIFEIVKELRSQ 239
                          250       260
                   ....*....|....*....|
gi 108802617   311 RSGMVQTKEQYHFCYDIVLE 330
Cdd:smart00194 240 RPGMVQTEEQYIFLYRAILE 259
Y_phosphatase pfam00102
Protein-tyrosine phosphatase;
102-330 2.52e-104

Protein-tyrosine phosphatase;


Pssm-ID: 249588 [Multi-domain]  Cd Length: 232  Bit Score: 308.45  E-value: 2.52e-104
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  102 NREKNRYRDILPYDSTRVPL--GKSKDYINASYIRIVNcgEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEG 179
Cdd:pfam00102   1 NLEKNRYKDVLPYDHTRVKLtpGGASDYINASYIDGYR--KPRAFIATQGPLPNTIEDFWRMVWEEKVTTIVMLTELEEK 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  180 GIIKCYHYWPISLKKPLELKHFRVFLENYQ-ILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRY 258
Cdd:pfam00102  79 GREKCAQYWPEEEEGSLTYGDISVTLVKEEeEEDDYTVRTLELTNGGSEETRTVTHFHYTGWPDHGVPESPKSLLDLIRK 158
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 108802617  259 ARKSH--LTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:pfam00102 159 VRKSQdpDNGPIVVHCSAGVGRTGTFIALDILLQQLEAEGEVDIFQIVKELRSQRPGMVQTEEQYIFLYDAVLE 232
COG5599 COG5599
Protein tyrosine phosphatase [Signal transduction mechanisms];
100-336 2.46e-58

Protein tyrosine phosphatase [Signal transduction mechanisms];


Pssm-ID: 227886 [Multi-domain]  Cd Length: 302  Bit Score: 192.37  E-value: 2.46e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 100 PSNREKNRYRDILPYDSTRVPLGKSK---DYINASYIRIvncgEEYFYIATQGPLLSTIDDFWQMVLENNSN--VIAMIT 174
Cdd:COG5599   51 STNYARNRYSNIVPYEHTRVHLKYGKsinDYINASYIKT----PRGKYIATQGPKPETIDDFWKMVWHNVPNngVIVMLT 126
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 175 REIEGGIIKCYHYWPISL--KKPLELKHFRVFLENYQILQYFIIRMFQVvEKSTGTSHSVKQLQFTKWPDHGTPaSADSF 252
Cdd:COG5599  127 SLPEYNREKCDQYWPLGYddTLIIGLRVIKQKKYELFNDNIVNVHNFEL-TSINGPPKKIHHFQYINWVDFNVP-DIRSL 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 253 IKYIRYARKSHL-TGPMVVHCSAGIGRTGVFLCVDVVF---------CAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYH 322
Cdd:COG5599  205 TEVIHSLNDSPVrTGPIIVHCSAGVGRTGTFIALDILLrmpndtlnhTDTWEDTQDLIFQIVLSLRSQRMKMVQNKTQFK 284
                        250
                 ....*....|....
gi 108802617 323 FCYDIVLEVLRKLL 336
Cdd:COG5599  285 FLYDAFLELNKSQI 298
PHA02747 PHA02747
protein tyrosine phosphatase; Provisional
78-339 8.91e-47

protein tyrosine phosphatase; Provisional


Pssm-ID: 165114 [Multi-domain]  Cd Length: 312  Bit Score: 162.48  E-value: 8.91e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  78 IMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPL----GKSKDYINASYIRIVNcgEEYFYIATQGPLLS 153
Cdd:PHA02747  27 IRDEHHQIILKPFDGLIANFEKPENQPKNRYWDIPCWDHNRVILdsggGSTSDYIHANWIDGFE--DDKKFIATQGPFAE 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 154 TIDDFWQMVLENNSNVIAMIT-REIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSV 232
Cdd:PHA02747 105 TCADFWKAVWQEHCSIIVMLTpTKGTNGEEKCYQYWCLNEDGNIDMEDFRIETLKTSVRAKYILTLIEITDKILKDSRKI 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 233 KQLQFTKWPDHGTPASADSFIKYIR------------YARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNI 300
Cdd:PHA02747 185 SHFQCSEWFEDETPSDHPDFIKFIKiidinrkksgklFNPKDALLCPIVVHCSDGVGKTGIFCAVDICLNQLVKRKAICL 264
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 108802617 301 MDIVAQMREQRSGMVQTKEQYHF---CYDIVLEVLRKLLTLD 339
Cdd:PHA02747 265 AKTAEKIREQRHAGIMNFDDYLFiqpGYEVLHYFLSKIKAID 306
PHA02742 PHA02742
protein tyrosine phosphatase; Provisional
63-330 4.62e-45

protein tyrosine phosphatase; Provisional


Pssm-ID: 165109 [Multi-domain]  Cd Length: 303  Bit Score: 157.47  E-value: 4.62e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  63 KDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSK---DYINASYIRIVNCG 139
Cdd:PHA02742  13 KNCEQLIEESNLAEILKEEHEHIMQEIVAFSCNESLELKNMKKCRYPDAPCFDRNRVILKIEDggdDFINASYVDGHNAK 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 140 EEYfyIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF 219
Cdd:PHA02742  93 GRF--ICTQAPLEETALDFWQAIFQDQVRVIVMITKIMEDGKEACYPYWMPHERGKATHGEFKIKTKKIKSFRNYAVTNL 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 220 QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTG-------------PMVVHCSAGIGRTGVFLCVD 286
Cdd:PHA02742 171 CLTDTNTGASLDIKHFAYEDWPHGGLPRDPNKFLDFVLAVREADLKAdvdikgenivkepPILVHCSAGLDRAGAFCAID 250
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 108802617 287 VVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLE 330
Cdd:PHA02742 251 ICISKYNERAIIPLLSIVRDLRKQRHNCLSLPQQYIFCYFIVLI 294
PHA02738 PHA02738
hypothetical protein; Provisional
57-328 3.58e-37

hypothetical protein; Provisional


Pssm-ID: 222923 [Multi-domain]  Cd Length: 320  Bit Score: 136.59  E-value: 3.58e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  57 HEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSgnQPSNREKNRYRDILPYDSTRVPLGKSK---DYINASYI 133
Cdd:PHA02738   6 FRELKYAEFLALMEKSDCEEVITREHQKVISEKVDGTFNA--EKKNRKLNRYLDAVCFDHSRVILPAERnrgDYINANYV 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 134 RivncGEEYF--YIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQIL 211
Cdd:PHA02738  84 D----GFEYKkkFICGQAPTRQTCYDFYRMLWMEHVQIIVMLCKKKENGREKCFPYWSDVEQGSIRFGKFKITTTQVETH 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 212 QYFIIRMFQVVEkSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYAR---------------KSHLTGPMVVHCSAGI 276
Cdd:PHA02738 160 PHYVKSTLLLTD-GTSATQTVTHFNFTAWPDHDVPKNTSEFLNFVLEVRqcqkelaqeslqighNRLQPPPIVVHCNAGL 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 108802617 277 GRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIV 328
Cdd:PHA02738 239 GRTPCYCVVDISISRFDACATVSIPSIVSSIRNQRYYSLFIPFQYFFCYRAV 290
PHA02746 PHA02746
protein tyrosine phosphatase; Provisional
53-332 3.79e-36

protein tyrosine phosphatase; Provisional


Pssm-ID: 165113 [Multi-domain]  Cd Length: 323  Bit Score: 134.00  E-value: 3.79e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  53 IFNFHEQT-AIKDCLKILEEKTAAYDImqefmalelkNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGK-------- 123
Cdd:PHA02746  11 AFDFFDKTnHAKFCEFVLLEHAEVMDI----------PIRGTTNHFLKKENLKKNRFHDIPCWDHSRVVINAheslkmfd 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 124 ------------SKD----YINASYIRivNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITrEIEGGIIKCYHY 187
Cdd:PHA02746  81 vgdsdgkkievtSEDnaenYIHANFVD--GFKEANKFICAQGPKEDTSEDFFKLISEHESQVIVSLT-DIDDDDEKCFEL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 188 WpiSLKKPLELKHFRVFLENYQILQ--YFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARK---- 261
Cdd:PHA02746 158 W--TKEEDSELAFGRFVAKILDIIEelSFTKTRLMITDKISDTSREIHHFWFPDWPDNGIPTGMAEFLELINKVNEeqae 235
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 108802617 262 --------SHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVL 332
Cdd:PHA02746 236 likqadndPQTLGPIVVHCSAGIGRAGTFCAIDNALEQLEKEKEVCLGEIVLKIRKQRHSSVFLPEQYAFCYKALKYAI 314
PHA02740 PHA02740
protein tyrosine phosphatase; Provisional
78-328 8.67e-19

protein tyrosine phosphatase; Provisional


Pssm-ID: 165107 [Multi-domain]  Cd Length: 298  Bit Score: 83.86  E-value: 8.67e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617  78 IMQEFMALelknLPGEFNSGNQPSNREKNRYRD------ILPYDSTRVPLGKSKDYINASYIRIVNcgEEYFYIATQGPL 151
Cdd:PHA02740  27 IIKEYRAI----VPEHEDEANKACAQAENKAKDenlalhITRLLHRRIKLFNDEKVLDARFVDGYD--FEQKFICIINLC 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 152 LSTIDDFWQMVLENNSNVIAMITREIEGgiiKCYH-YWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKStGTSH 230
Cdd:PHA02740 101 EDACDKFLQALSDNKVQIIVLISRHADK---KCFNqFWSLKEGCVITSDKFQIETLEIIIKPHFNLTLLSLTDKF-GQAQ 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 231 SVKQLQFTKWPDHGTPASADSFIKY----------IRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNI 300
Cdd:PHA02740 177 KISHFQYTAWPADGFSHDPDAFIDFfcniddlcadLEKHKADGKIAPIIIDCIDGISSSAVFCVFDICATEFDKTGMLSI 256
                        250       260
                 ....*....|....*....|....*...
gi 108802617 301 MDIVAQMREQRSGMVQTKEQYHFCYDIV 328
Cdd:PHA02740 257 ANALKKVRQKKYGCMNCLDDYVFCYHLI 284
CDC14 COG2453
Protein-tyrosine phosphatase [Signal transduction mechanisms];
240-335 9.31e-10

Protein-tyrosine phosphatase [Signal transduction mechanisms];


Pssm-ID: 225297 [Multi-domain]  Cd Length: 180  Bit Score: 55.92  E-value: 9.31e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 108802617 240 WPDHGTPASAD--SFIKYIRYARKSHltGPMVVHCSAGIGRTGvflCVDVVFCAIVKNCsFNIMDIVAQMREQRSGMVQT 317
Cdd:COG2453   80 ILDGTVPDLEDldKIVDFIEEALSKG--KKVVVHCQGGIGRSG---TVIAAYLMLYGGL-SLADEAIAVKRRRRPGAVVT 153
                         90
                 ....*....|....*...
gi 108802617 318 KEQYHFCYDIVLEVLRKL 335
Cdd:COG2453  154 EIQHLFELEQELFRKKEL 171
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH