NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|54873644|ref|NP_001006669|]
View 

potassium voltage-gated channel subfamily KQT member 2 isoform 4 [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KCNQ_channel super family cl04130
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
424-661 4.53e-81

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


The actual alignment was detected with superfamily member pfam03520:

Pssm-ID: 252008  Cd Length: 193  Bit Score: 258.95  E-value: 4.53e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   424 RRSPSADQS-LDDSPSKVPK----SWSFGDRSRTRQAFRikgaasrqnseEASLPGEDIVEDNKSCNCEFVTEDLTPGLK 498
Cdd:pfam03520   1 RRSPSSEIDgYDSSPSKVPKslrvSWSFNDRTRFRASLR-----------NSEAPSLDEVEDEKELRCITTVEQLTPRHK 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   499 VSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSridmivgppppstprhkkyptkgptapsre 578
Cdd:pfam03520  70 TVIRAIRIMKYFVAKRKFKEALKPYDVKDVIEQYSAGHLDLLGRIKSLQR------------------------------ 119
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   579 spqyspRVDQIVGRGPTITDKD-RTKgpaeteLPEDPSMMGRLGKVEKQVLSMEKKLDFLVSI--YTQRMGIPPAETEAY 655
Cdd:pfam03520 120 ------RLDQILGKGGSPADKKeRSK------DRGDISMMGRVVKVERQVQSIEQKLDLLLDMleYQQRFRAGPGPPKPL 187

                  ....*.
gi 54873644   656 FGAKEP 661
Cdd:pfam03520 188 TSAQSP 193
Ion_trans_2 pfam07885
Ion channel; This family includes the two membrane helix type ion channels found in bacteria.
240-313 1.37e-14

Ion channel; This family includes the two membrane helix type ion channels found in bacteria.


:

Pssm-ID: 254488  Cd Length: 75  Bit Score: 69.98  E-value: 1.37e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 54873644   240 FLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILG 313
Cdd:pfam07885   2 LLLLVLIFGTVYYLLEKEGWEGWSFLDALYFSFTTLTTIGYGDIVPLTDAGRLFTIIYILIGIPLFLLFLAVLG 75
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
128-312 6.92e-31

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 120.47  E-value: 6.92e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   128 ILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVIDIMVLIASIAVLAA-----GSQGNVFATSALRSLRF 202
Cdd:pfam00520   1 ILDYVFTVIFTLEMLLKFIALGFKLSY---------FRSPWNILDFLVVLPSLVSLILrllgeGSEGLLSVLRLLRLLRL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   203 LQILRMIRMDRrggtwKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEK-------------GENDHFDTYADALW 269
Cdd:pfam00520  72 LRLLRRFPGLR-----TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGefdkcedenenpiNGNSNFDSYPEALL 146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 54873644   270 WGLITLTTIGYGDKYPQ-----TWNGRLLAATFTLIG-VSFFALPAGIL 312
Cdd:pfam00520 147 WLFRTLTTEGWGDIMPDtldagTVLGKIFFVIFIILGgFLLLNLLIGVI 195
 
Name Accession Description Interval E-value
KCNQ_channel pfam03520
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
424-661 4.53e-81

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


Pssm-ID: 252008  Cd Length: 193  Bit Score: 258.95  E-value: 4.53e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   424 RRSPSADQS-LDDSPSKVPK----SWSFGDRSRTRQAFRikgaasrqnseEASLPGEDIVEDNKSCNCEFVTEDLTPGLK 498
Cdd:pfam03520   1 RRSPSSEIDgYDSSPSKVPKslrvSWSFNDRTRFRASLR-----------NSEAPSLDEVEDEKELRCITTVEQLTPRHK 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   499 VSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSridmivgppppstprhkkyptkgptapsre 578
Cdd:pfam03520  70 TVIRAIRIMKYFVAKRKFKEALKPYDVKDVIEQYSAGHLDLLGRIKSLQR------------------------------ 119
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   579 spqyspRVDQIVGRGPTITDKD-RTKgpaeteLPEDPSMMGRLGKVEKQVLSMEKKLDFLVSI--YTQRMGIPPAETEAY 655
Cdd:pfam03520 120 ------RLDQILGKGGSPADKKeRSK------DRGDISMMGRVVKVERQVQSIEQKLDLLLDMleYQQRFRAGPGPPKPL 187

                  ....*.
gi 54873644   656 FGAKEP 661
Cdd:pfam03520 188 TSAQSP 193
Ion_trans_2 pfam07885
Ion channel; This family includes the two membrane helix type ion channels found in bacteria.
240-313 1.37e-14

Ion channel; This family includes the two membrane helix type ion channels found in bacteria.


Pssm-ID: 254488  Cd Length: 75  Bit Score: 69.98  E-value: 1.37e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 54873644   240 FLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILG 313
Cdd:pfam07885   2 LLLLVLIFGTVYYLLEKEGWEGWSFLDALYFSFTTLTTIGYGDIVPLTDAGRLFTIIYILIGIPLFLLFLAVLG 75
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
128-312 6.92e-31

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 120.47  E-value: 6.92e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   128 ILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVIDIMVLIASIAVLAA-----GSQGNVFATSALRSLRF 202
Cdd:pfam00520   1 ILDYVFTVIFTLEMLLKFIALGFKLSY---------FRSPWNILDFLVVLPSLVSLILrllgeGSEGLLSVLRLLRLLRL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   203 LQILRMIRMDRrggtwKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEK-------------GENDHFDTYADALW 269
Cdd:pfam00520  72 LRLLRRFPGLR-----TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGefdkcedenenpiNGNSNFDSYPEALL 146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 54873644   270 WGLITLTTIGYGDKYPQ-----TWNGRLLAATFTLIG-VSFFALPAGIL 312
Cdd:pfam00520 147 WLFRTLTTEGWGDIMPDtldagTVLGKIFFVIFIILGgFLLLNLLIGVI 195
AF-4 pfam05110
AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E ...
412-730 6.12e-05

AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E mental retardation syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental retardation. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila.


Pssm-ID: 253015 [Multi-domain]  Cd Length: 1154  Bit Score: 45.30  E-value: 6.12e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    412 AKGKGSPQAQTVRRS-----PSADQSLDDSPSK-VPKSWSFGDrsrtrqafriKGAASRQNSEEASLPGEDIVEDNKSCN 485
Cdd:pfam05110  580 AATKGSRKPSPRKEPkssvpPAAEKRKYKSPSKiVPKSREFIE----------TDSSSSDSPEDESLPPSSQSPGNTESS 649
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    486 CEFVTEDLTPGLKVSIRA---VCVMRFLVSKRK------FKESLRPYDVMDVIEqysaghLDMLSRIKSLQSridmivGP 556
Cdd:pfam05110  650 KESCASLRTPVCRSSVGSqndLSKDRLLSPMREtellspLRDSEERYSLWVKID------LDLLSRIPGHPY------KK 717
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    557 PPPSTPRHKKYPTKGPTAPSRE-SPQYSPRVdqivgrgptitdKDRTKGPAETELPEDpsmmgRLGKVEKQVLSMEKKLD 635
Cdd:pfam05110  718 GVPPKPAEKDSLSAPKKQTSKTaSEKSSSKG------------KRKHKNDEEADKIES-----KKQRLEEKSSSCSPSSS 780
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    636 flVSIYTQRMGIPPAETEAyfgAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSW 715
Cdd:pfam05110  781 --SSHHHSSSNKESRKSSR---NKEEEMLPSPSSPLSSSSPKPEHPSRKRPRRQEDTSSSSGPFSASSTKSSSKSSSTSK 855
                          330
                   ....*....|....*
gi 54873644    716 QQSHQRHGTSPVGDH 730
Cdd:pfam05110  856 HRKTEGKGSSTSKEH 870
PRK10537 PRK10537
voltage-gated potassium channel; Provisional
267-306 4.24e-03

voltage-gated potassium channel; Provisional


Pssm-ID: 236711 [Multi-domain]  Cd Length: 393  Bit Score: 38.85  E-value: 4.24e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 54873644  267 ALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFA 306
Cdd:PRK10537 172 AFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFA 211
 
Name Accession Description Interval E-value
KCNQ_channel pfam03520
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
424-661 4.53e-81

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


Pssm-ID: 252008  Cd Length: 193  Bit Score: 258.95  E-value: 4.53e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   424 RRSPSADQS-LDDSPSKVPK----SWSFGDRSRTRQAFRikgaasrqnseEASLPGEDIVEDNKSCNCEFVTEDLTPGLK 498
Cdd:pfam03520   1 RRSPSSEIDgYDSSPSKVPKslrvSWSFNDRTRFRASLR-----------NSEAPSLDEVEDEKELRCITTVEQLTPRHK 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   499 VSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSridmivgppppstprhkkyptkgptapsre 578
Cdd:pfam03520  70 TVIRAIRIMKYFVAKRKFKEALKPYDVKDVIEQYSAGHLDLLGRIKSLQR------------------------------ 119
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   579 spqyspRVDQIVGRGPTITDKD-RTKgpaeteLPEDPSMMGRLGKVEKQVLSMEKKLDFLVSI--YTQRMGIPPAETEAY 655
Cdd:pfam03520 120 ------RLDQILGKGGSPADKKeRSK------DRGDISMMGRVVKVERQVQSIEQKLDLLLDMleYQQRFRAGPGPPKPL 187

                  ....*.
gi 54873644   656 FGAKEP 661
Cdd:pfam03520 188 TSAQSP 193
Ion_trans_2 pfam07885
Ion channel; This family includes the two membrane helix type ion channels found in bacteria.
240-313 1.37e-14

Ion channel; This family includes the two membrane helix type ion channels found in bacteria.


Pssm-ID: 254488  Cd Length: 75  Bit Score: 69.98  E-value: 1.37e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 54873644   240 FLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILG 313
Cdd:pfam07885   2 LLLLVLIFGTVYYLLEKEGWEGWSFLDALYFSFTTLTTIGYGDIVPLTDAGRLFTIIYILIGIPLFLLFLAVLG 75
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
128-312 6.92e-31

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 120.47  E-value: 6.92e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   128 ILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVIDIMVLIASIAVLAA-----GSQGNVFATSALRSLRF 202
Cdd:pfam00520   1 ILDYVFTVIFTLEMLLKFIALGFKLSY---------FRSPWNILDFLVVLPSLVSLILrllgeGSEGLLSVLRLLRLLRL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   203 LQILRMIRMDRrggtwKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEK-------------GENDHFDTYADALW 269
Cdd:pfam00520  72 LRLLRRFPGLR-----TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGefdkcedenenpiNGNSNFDSYPEALL 146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 54873644   270 WGLITLTTIGYGDKYPQ-----TWNGRLLAATFTLIG-VSFFALPAGIL 312
Cdd:pfam00520 147 WLFRTLTTEGWGDIMPDtldagTVLGKIFFVIFIILGgFLLLNLLIGVI 195
AF-4 pfam05110
AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E ...
412-730 6.12e-05

AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E mental retardation syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental retardation. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila.


Pssm-ID: 253015 [Multi-domain]  Cd Length: 1154  Bit Score: 45.30  E-value: 6.12e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    412 AKGKGSPQAQTVRRS-----PSADQSLDDSPSK-VPKSWSFGDrsrtrqafriKGAASRQNSEEASLPGEDIVEDNKSCN 485
Cdd:pfam05110  580 AATKGSRKPSPRKEPkssvpPAAEKRKYKSPSKiVPKSREFIE----------TDSSSSDSPEDESLPPSSQSPGNTESS 649
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    486 CEFVTEDLTPGLKVSIRA---VCVMRFLVSKRK------FKESLRPYDVMDVIEqysaghLDMLSRIKSLQSridmivGP 556
Cdd:pfam05110  650 KESCASLRTPVCRSSVGSqndLSKDRLLSPMREtellspLRDSEERYSLWVKID------LDLLSRIPGHPY------KK 717
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    557 PPPSTPRHKKYPTKGPTAPSRE-SPQYSPRVdqivgrgptitdKDRTKGPAETELPEDpsmmgRLGKVEKQVLSMEKKLD 635
Cdd:pfam05110  718 GVPPKPAEKDSLSAPKKQTSKTaSEKSSSKG------------KRKHKNDEEADKIES-----KKQRLEEKSSSCSPSSS 780
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    636 flVSIYTQRMGIPPAETEAyfgAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSW 715
Cdd:pfam05110  781 --SSHHHSSSNKESRKSSR---NKEEEMLPSPSSPLSSSSPKPEHPSRKRPRRQEDTSSSSGPFSASSTKSSSKSSSTSK 855
                          330
                   ....*....|....*
gi 54873644    716 QQSHQRHGTSPVGDH 730
Cdd:pfam05110  856 HRKTEGKGSSTSKEH 870
PRK10537 PRK10537
voltage-gated potassium channel; Provisional
267-306 4.24e-03

voltage-gated potassium channel; Provisional


Pssm-ID: 236711 [Multi-domain]  Cd Length: 393  Bit Score: 38.85  E-value: 4.24e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 54873644  267 ALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFA 306
Cdd:PRK10537 172 AFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFA 211
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH