NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|13957745|gb|AAK50633|]
View 

germ cell-less protein [Oryzias latipes]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
72-179 1.92e-14

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


:

Pssm-ID: 250031  Cd Length: 107  Bit Score: 69.61  E-value: 1.92e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745    72 LFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDdVLIKPS 150
Cdd:pfam00651   4 LRENGELCDVTLVVGDKEFKAHKAVLAaCSPYFKALFSSNEEESSVVEITL----EDVSPEDFEALLEFIYTG-KLISEE 78
                          90       100
                  ....*....|....*....|....*....
gi 13957745   151 RVISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:pfam00651  79 NVEDLLALADKLQIPALIDKCEEFLIKSL 107
BACK smart00875
BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are ...
184-254 2.82e-10

BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.


:

Pssm-ID: 197943  Cd Length: 101  Bit Score: 57.35  E-value: 2.82e-10
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745    184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWM 254
Cdd:smart00875   1 CLGIRRFADAHGLEELAEKALRFILQNFSEVSSSEEFLELPLEQLLELLSSDDLNVSS-EEEVFEAVLRWV 70
 
Name Accession Description Interval E-value
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
72-179 1.92e-14

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 250031  Cd Length: 107  Bit Score: 69.61  E-value: 1.92e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745    72 LFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDdVLIKPS 150
Cdd:pfam00651   4 LRENGELCDVTLVVGDKEFKAHKAVLAaCSPYFKALFSSNEEESSVVEITL----EDVSPEDFEALLEFIYTG-KLISEE 78
                          90       100
                  ....*....|....*....|....*....
gi 13957745   151 RVISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:pfam00651  79 NVEDLLALADKLQIPALIDKCEEFLIKSL 107
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
80-179 3.08e-13

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585  Cd Length: 97  Bit Score: 65.79  E-value: 3.08e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745     80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYLD----DVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 13957745    159 ACMLQLDGLIQQCGETMKENI 179
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
BACK smart00875
BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are ...
184-254 2.82e-10

BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.


Pssm-ID: 197943  Cd Length: 101  Bit Score: 57.35  E-value: 2.82e-10
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745    184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWM 254
Cdd:smart00875   1 CLGIRRFADAHGLEELAEKALRFILQNFSEVSSSEEFLELPLEQLLELLSSDDLNVSS-EEEVFEAVLRWV 70
BACK pfam07707
BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The ...
184-254 6.01e-04

BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).


Pssm-ID: 254375  Cd Length: 103  Bit Score: 38.29  E-value: 6.01e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13957745   184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMT-HQNVDLMkELGVEVMEQLIQSSDLFVmQVEMDVYTALKKWM 254
Cdd:pfam07707   1 CLGIYRFADTYGCEELAEVALRFILKNFLEvSKSEEFL-ELSKEQLLELLSSDELNV-ESEEEVFEAVIKWV 70
PHA03098 PHA03098
kelch-like protein; Provisional
71-253 4.27e-05

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 44.76  E-value: 4.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   71 TLFLNGENSDIR--IRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKEsnmMEINLeipdqNIDTEALQVVFGSLYRDDVLI 147
Cdd:PHA03098   2 YSFELQKFCDESiiIVNGGGIIKVHKIILSSsSEYFKKMFKNNFKE---NEINL-----NIDYDSFNEVIKYIYTGKINI 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEV 227
Cdd:PHA03098  74 TSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPDFIYLSKNE 153
                        170       180
                 ....*....|....*....|....*.
gi 13957745  228 MEQLIQSSDLFVMQvEMDVYTALKKW 253
Cdd:PHA03098 154 LIKILSDDKLNVSS-EDVVLEIIIKW 178
 
Name Accession Description Interval E-value
BTB pfam00651
BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain ...
72-179 1.92e-14

BTB/POZ domain; The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerization and in some instances heteromeric dimerization. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.


Pssm-ID: 250031  Cd Length: 107  Bit Score: 69.61  E-value: 1.92e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745    72 LFLNGENSDIRIRALGQEWNLHKVYLC-QSGYFSSMFSGSWKESNMMEINLeipdQNIDTEALQVVFGSLYRDdVLIKPS 150
Cdd:pfam00651   4 LRENGELCDVTLVVGDKEFKAHKAVLAaCSPYFKALFSSNEEESSVVEITL----EDVSPEDFEALLEFIYTG-KLISEE 78
                          90       100
                  ....*....|....*....|....*....
gi 13957745   151 RVISVLAGACMLQLDGLIQQCGETMKENI 179
Cdd:pfam00651  79 NVEDLLALADKLQIPALIDKCEEFLIKSL 107
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
80-179 3.08e-13

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585  Cd Length: 97  Bit Score: 65.79  E-value: 3.08e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745     80 DIRIRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMMEINLEipdqNIDTEALQVVFGSLYRDDVLIKPSRVISVLAG 158
Cdd:smart00225   1 DVTLVVGGKKFHAHKAVLAAhSPYFKALFSSDFKESDKSEIYLD----DVSPEDFRALLNFLYTGKLDLPEENVEELLEL 76
                           90       100
                   ....*....|....*....|.
gi 13957745    159 ACMLQLDGLIQQCGETMKENI 179
Cdd:smart00225  77 ADYLQIPGLVELCEEFLLKLL 97
BACK smart00875
BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are ...
184-254 2.82e-10

BTB And C-terminal Kelch; The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues.


Pssm-ID: 197943  Cd Length: 101  Bit Score: 57.35  E-value: 2.82e-10
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 13957745    184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQvEMDVYTALKKWM 254
Cdd:smart00875   1 CLGIRRFADAHGLEELAEKALRFILQNFSEVSSSEEFLELPLEQLLELLSSDDLNVSS-EEEVFEAVLRWV 70
BACK pfam07707
BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The ...
184-254 6.01e-04

BTB And C-terminal Kelch; This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).


Pssm-ID: 254375  Cd Length: 103  Bit Score: 38.29  E-value: 6.01e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 13957745   184 VCGYYHCASIYGLDSVMKKCLEWLLNNLMT-HQNVDLMkELGVEVMEQLIQSSDLFVmQVEMDVYTALKKWM 254
Cdd:pfam07707   1 CLGIYRFADTYGCEELAEVALRFILKNFLEvSKSEEFL-ELSKEQLLELLSSDELNV-ESEEEVFEAVIKWV 70
PHA03098 PHA03098
kelch-like protein; Provisional
71-253 4.27e-05

kelch-like protein; Provisional


Pssm-ID: 222983 [Multi-domain]  Cd Length: 534  Bit Score: 44.76  E-value: 4.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   71 TLFLNGENSDIR--IRALGQEWNLHKVYLCQ-SGYFSSMFSGSWKEsnmMEINLeipdqNIDTEALQVVFGSLYRDDVLI 147
Cdd:PHA03098   2 YSFELQKFCDESiiIVNGGGIIKVHKIILSSsSEYFKKMFKNNFKE---NEINL-----NIDYDSFNEVIKYIYTGKINI 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  148 KPSRVISVLAGACMLQLDGLIQQCGETMKENISAKTVCGYYHCASIYGLDSVMKKCLEWLLNNLMTHQNVDLMKELGVEV 227
Cdd:PHA03098  74 TSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLYSAAYNYIRNNIELIYNDPDFIYLSKNE 153
                        170       180
                 ....*....|....*....|....*.
gi 13957745  228 MEQLIQSSDLFVMQvEMDVYTALKKW 253
Cdd:PHA03098 154 LIKILSDDKLNVSS-EDVVLEIIIKW 178
PHA02713 PHA02713
hypothetical protein; Provisional
87-254 7.59e-04

hypothetical protein; Provisional


Pssm-ID: 165086 [Multi-domain]  Cd Length: 557  Bit Score: 40.76  E-value: 7.59e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745   87 GQEWNLHKVYLCQ-SGYFSSMFSGSWKESNMM-EINLeipdQNIDTEALQVVFGSLYRDDvlIKPSRVISVLAGACMLQL 164
Cdd:PHA02713  35 GEEIKAHKTILAAgSKYFRTLFTTPMIIRDLVtRVNL----QMFDKDAVKNIVQYLYNRH--ISSMNVIDVLKCADYLLI 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13957745  165 DGLIQQCGETMKENISAKTVCGYYHcaSIYGLD--SVMKKCLEWLLNNLMTHQNVDLMKELGVEVMEQLIQSSDLFVMQV 242
Cdd:PHA02713 109 DDLVTDCESYIKDYTNHDTCIYMYH--RLYEMShiPIVKYIKRMLMSNIPTLITTDAFKKTVFEILFDIISTNDNVYLYR 186
                        170
                 ....*....|..
gi 13957745  243 EMDVYTALKKWM 254
Cdd:PHA02713 187 EGYKVTILLKWL 198
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH