NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|99081817|ref|YP_613971|]
View 

methyl-accepting chemotaxis sensory transducer [Ruegeria sp. TM1040]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
246-445 6.61e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 146.23  E-value: 6.61e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 246 ESQAATLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQT 325
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 326 NLLALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASEL 405
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 99081817 406 TEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQST 445
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
4-162 9.70e-34

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


:

Pssm-ID: 256506  Cd Length: 156  Bit Score: 124.62  E-value: 9.70e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817     4 DMNALLATYDLDGANQALLQKRAKMILGLLPEVLDHFYDRVGREPEMAAFFKTEAMMERAKGEQLQHWSRLFSGDFGEDY 83
Cdd:pfam11563   2 RLEYRLRFLGLTEEDLAALRALRPLIEPHIPAILDRFYEKLLSHPETARIFTDESQIERLKKTLRAYLLELFSGPYDEAY 81
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 99081817    84 IQSARNIGRVHTRIGLPFSFFNAGYAHANAHIQALILKRHSgglmRRATETHALLGVLSRAMALDIQLIFDAHAEAMQE 162
Cdd:pfam11563  82 VEYRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALLEKIR----LSAAELTALVRALSKLINLDQDLVLSAYEEELEE 156
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
100-467 9.56e-56

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 192.90  E-value: 9.56e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 100 PFSFFNAGYAHANAHIQALILKRHSGGLMRRATETHALLGVLSRAMALDIQLIFdahaeAMQEEHTRGVRYITEAIEALA 179
Cdd:COG0840  25 KLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAI-----LLLRAILEPISDLLEVVERIA 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 180 AQDLSHEMpsaqTGDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAV 259
Cdd:COG0840 100 AGDLTKRI----DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAI 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 260 EEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDI-----------SFQTNLL 328
Cdd:COG0840 176 EELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieeitsvinsiAEQTNLL 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 329 ALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLI--------------DISNDHVESGVELVGNAGRMLES 394
Cdd:COG0840 256 ALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGE 335
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 99081817 395 IVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRL 467
Cdd:COG0840 336 IAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
246-445 6.61e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 146.23  E-value: 6.61e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 246 ESQAATLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQT 325
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 326 NLLALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASEL 405
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 99081817 406 TEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQST 445
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
4-162 9.70e-34

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 124.62  E-value: 9.70e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817     4 DMNALLATYDLDGANQALLQKRAKMILGLLPEVLDHFYDRVGREPEMAAFFKTEAMMERAKGEQLQHWSRLFSGDFGEDY 83
Cdd:pfam11563   2 RLEYRLRFLGLTEEDLAALRALRPLIEPHIPAILDRFYEKLLSHPETARIFTDESQIERLKKTLRAYLLELFSGPYDEAY 81
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 99081817    84 IQSARNIGRVHTRIGLPFSFFNAGYAHANAHIQALILKRHSgglmRRATETHALLGVLSRAMALDIQLIFDAHAEAMQE 162
Cdd:pfam11563  82 VEYRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALLEKIR----LSAAELTALVRALSKLINLDQDLVLSAYEEELEE 156
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
3-154 5.72e-28

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 108.12  E-value: 5.72e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   3 FDMNALLATYDLDGANQALLQKRAKMILGLLPEVLDHFYDRVGREPEMAAFFKTEAMMERAKGEQLQHWSRLFSGDFGED 82
Cdd:cd01068   1 AELDERLAFLGLDEDDLSLLKALRPVIEANADELVDRFYDHLRRTPETAAFLGDESVVERLKSTQRRHWVELFSGVYDEA 80
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 99081817  83 YIQSARNIGRVHTRIGLPFSFFNAGYAHANAHIQALILKRhsgglMRRATETHALLGVLSRAMALDIQLIFD 154
Cdd:cd01068  81 YIAQRVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRES-----ILSADELAQALRALIKLLDLDMDLVTS 147
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
100-467 9.56e-56

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 192.90  E-value: 9.56e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 100 PFSFFNAGYAHANAHIQALILKRHSGGLMRRATETHALLGVLSRAMALDIQLIFdahaeAMQEEHTRGVRYITEAIEALA 179
Cdd:COG0840  25 KLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAI-----LLLRAILEPISDLLEVVERIA 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 180 AQDLSHEMpsaqTGDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAV 259
Cdd:COG0840 100 AGDLTKRI----DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAI 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 260 EEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDI-----------SFQTNLL 328
Cdd:COG0840 176 EELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieeitsvinsiAEQTNLL 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 329 ALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLI--------------DISNDHVESGVELVGNAGRMLES 394
Cdd:COG0840 256 ALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGE 335
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 99081817 395 IVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRL 467
Cdd:COG0840 336 IAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
171-468 6.41e-59

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 204.80  E-value: 6.41e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  171 ITEAIEALAAQDLSHEMPSaqtgDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAA 250
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEV----DGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAA 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  251 TLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLAL 330
Cdd:PRK15041 301 SLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILAL 380
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  331 NAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVA 410
Cdd:PRK15041 381 NAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIA 460
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 99081817  411 SAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRLR 468
Cdd:PRK15041 461 SASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ 518
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
220-466 4.58e-54

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 184.03  E-value: 4.58e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    220 IRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVE 299
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    300 KMNEIADSSVQISKIISIIDDISFQTNLLALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLI-------- 371
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    372 ------DISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQST 445
Cdd:smart00283 162 eavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 99081817    446 AALVEMRNDASALNALVEVFR 466
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
270-467 7.66e-39

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 141.04  E-value: 7.66e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   270 AEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLALNAGVEAARAGESGRGFAVV 349
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   350 ASEVRNLAQRTADSAAEIKGLIDIS--------------NDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAEQ 415
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEIvkqtndstasiqqtRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 99081817   416 QSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRL 467
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
246-445 6.61e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 146.23  E-value: 6.61e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 246 ESQAATLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQT 325
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 326 NLLALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASEL 405
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 99081817 406 TEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQST 445
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
4-162 9.70e-34

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 124.62  E-value: 9.70e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817     4 DMNALLATYDLDGANQALLQKRAKMILGLLPEVLDHFYDRVGREPEMAAFFKTEAMMERAKGEQLQHWSRLFSGDFGEDY 83
Cdd:pfam11563   2 RLEYRLRFLGLTEEDLAALRALRPLIEPHIPAILDRFYEKLLSHPETARIFTDESQIERLKKTLRAYLLELFSGPYDEAY 81
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 99081817    84 IQSARNIGRVHTRIGLPFSFFNAGYAHANAHIQALILKRHSgglmRRATETHALLGVLSRAMALDIQLIFDAHAEAMQE 162
Cdd:pfam11563  82 VEYRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALLEKIR----LSAAELTALVRALSKLINLDQDLVLSAYEEELEE 156
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
3-154 5.72e-28

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 108.12  E-value: 5.72e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   3 FDMNALLATYDLDGANQALLQKRAKMILGLLPEVLDHFYDRVGREPEMAAFFKTEAMMERAKGEQLQHWSRLFSGDFGED 82
Cdd:cd01068   1 AELDERLAFLGLDEDDLSLLKALRPVIEANADELVDRFYDHLRRTPETAAFLGDESVVERLKSTQRRHWVELFSGVYDEA 80
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 99081817  83 YIQSARNIGRVHTRIGLPFSFFNAGYAHANAHIQALILKRhsgglMRRATETHALLGVLSRAMALDIQLIFD 154
Cdd:cd01068  81 YIAQRVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRES-----ILSADELAQALRALIKLLDLDMDLVTS 147
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
220-305 9.10e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 36.06  E-value: 9.10e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 220 IRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAVEEITVSMrasaeatQQTRNAVDTTRRRAEEGSAVVRNAVE 299
Cdd:cd11386 122 IEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASV-------EEVADGIQEISAATQEQSASTQEIAA 194

                ....*.
gi 99081817 300 KMNEIA 305
Cdd:cd11386 195 AVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
100-467 9.56e-56

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 192.90  E-value: 9.56e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 100 PFSFFNAGYAHANAHIQALILKRHSGGLMRRATETHALLGVLSRAMALDIQLIFdahaeAMQEEHTRGVRYITEAIEALA 179
Cdd:COG0840  25 KLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAI-----LLLRAILEPISDLLEVVERIA 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 180 AQDLSHEMpsaqTGDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAV 259
Cdd:COG0840 100 AGDLTKRI----DESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAI 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 260 EEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDI-----------SFQTNLL 328
Cdd:COG0840 176 EELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieeitsvinsiAEQTNLL 255
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817 329 ALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLI--------------DISNDHVESGVELVGNAGRMLES 394
Cdd:COG0840 256 ALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIeeiqneaadavehmEESASEVSEGVKLVEETGSSLGE 335
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 99081817 395 IVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRL 467
Cdd:COG0840 336 IAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
171-468 6.41e-59

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 204.80  E-value: 6.41e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  171 ITEAIEALAAQDLSHEMPSaqtgDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAA 250
Cdd:PRK15041 225 LIDSIRHIAGGDLVKPIEV----DGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAA 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  251 TLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLAL 330
Cdd:PRK15041 301 SLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILAL 380
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  331 NAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVA 410
Cdd:PRK15041 381 NAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIA 460
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 99081817  411 SAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRLR 468
Cdd:PRK15041 461 SASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ 518
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
197-468 4.70e-55

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 193.75  E-value: 4.70e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  197 SEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAVEEITVSMRASAEATQQT 276
Cdd:PRK09793 243 NEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQA 322
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  277 RNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLALNAGVEAARAGESGRGFAVVASEVRNL 356
Cdd:PRK09793 323 SELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNL 402
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  357 AQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQ 436
Cdd:PRK09793 403 ASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQ 482
                        250       260       270
                 ....*....|....*....|....*....|..
gi 99081817  437 NAAMVEQSTAALVEMRNDASALNALVEVFRLR 468
Cdd:PRK09793 483 NASLVEEAAVATEQLANQADHLSSRVAVFTLE 514
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
175-485 1.15e-54

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 192.91  E-value: 1.15e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  175 IEALAAQDLSHEMpsaqTGDFPSEFNGVRESLNAAFGALRQVIQGIRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEE 254
Cdd:PRK15048 227 IREIAGGNLANTL----TIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEE 302
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  255 TTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLALNAGV 334
Cdd:PRK15048 303 TAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAV 382
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  335 EAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLIDISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAE 414
Cdd:PRK15048 383 EAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASD 462
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 99081817  415 QQSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRLRAGEQGGGGQEIALRAAS 485
Cdd:PRK15048 463 EQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASE 533
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
220-466 4.58e-54

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 184.03  E-value: 4.58e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    220 IRSTAQQLDTGAAEVSHASQDLSQRTESQAATLEETTAAVEEITVSMRASAEATQQTRNAVDTTRRRAEEGSAVVRNAVE 299
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    300 KMNEIADSSVQISKIISIIDDISFQTNLLALNAGVEAARAGESGRGFAVVASEVRNLAQRTADSAAEIKGLI-------- 371
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIkeiqeetn 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817    372 ------DISNDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAEQQSTAFGEINIGMSQLDTVTQQNAAMVEQST 445
Cdd:smart00283 162 eavaamEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|.
gi 99081817    446 AALVEMRNDASALNALVEVFR 466
Cdd:smart00283 242 AAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
270-467 7.66e-39

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 141.04  E-value: 7.66e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   270 AEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEIADSSVQISKIISIIDDISFQTNLLALNAGVEAARAGESGRGFAVV 349
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817   350 ASEVRNLAQRTADSAAEIKGLIDIS--------------NDHVESGVELVGNAGRMLESIVRHIKEASELTEQVASAAEQ 415
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEIvkqtndstasiqqtRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 99081817   416 QSTAFGEINIGMSQLDTVTQQNAAMVEQSTAALVEMRNDASALNALVEVFRL 467
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
PRK10547 PRK10547
chemotaxis protein CheA; Provisional
148-304 5.83e-03

chemotaxis protein CheA; Provisional


Pssm-ID: 236712 [Multi-domain]  Cd Length: 670  Bit Score: 37.79  E-value: 5.83e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  148 DI-QLIFDAHAEAmQEEHTRGVRYITEAIEALA-------------AQDLSHEMPSAQTGDFPSEFNGVRESLN------ 207
Cdd:PRK10547  94 DImQEQLDAYKTS-QEPDAASFEYICQALRQLAleakgetpsavtrLSVVAIQEKSEPQDESPRSQSGLRIILSrlkage 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 99081817  208 --------AAFGALRQVIQGIRSTAQQLDTGAAE---------VSHASQ----DLSQRTESQAATLEETTAAVEEITVSM 266
Cdd:PRK10547 173 vdlleeelGNLGTLTDVVKGADSLEATLPGSVAEdditavlcfVIEADQitfeTAVAAPQEKAEETTEVVEVSPKISVPP 252
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 99081817  267 RASAEATQQTRNAVDTTRRRAEEGSAVVRNAVEKMNEI 304
Cdd:PRK10547 253 VLKLAAEQAPAGRVEREKTARSSESTSIRVAVEKVDQL 290
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH