NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|91783857|ref|YP_559063|]
View 

methyl-accepting chemotaxis sensory transducer [Burkholderia xenovorans LB400]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
112-309 4.83e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 118.49  E-value: 4.83e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 112 IAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIESQIGALRSALAHVSRVSEEISLIARQTHLLALNAAI 191
Cdd:cd11386  10 VAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAI 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 192 EAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEqlisEGSANtarAHRVREGTRKIGDVVHATGDAIA 271
Cdd:cd11386  90 EAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTE----EAVEA---MEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 91783857 272 HLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSS 309
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
76-334 1.51e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 127.40  E-value: 1.51e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857     76 DVSGHVEEVAARVQRQAHVCRALRESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIE 155
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    156 SQIGALRSALAHVSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQT 235
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    236 EQLISEGSANTARAHRVREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSSENFAQA 315
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*....
gi 91783857    316 KDRLGNLLDVSETLIELTA 334
Cdd:smart00283 241 SAAAEELSGLAEELDELVE 259
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
112-309 4.83e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 118.49  E-value: 4.83e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 112 IAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIESQIGALRSALAHVSRVSEEISLIARQTHLLALNAAI 191
Cdd:cd11386  10 VAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAI 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 192 EAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEqlisEGSANtarAHRVREGTRKIGDVVHATGDAIA 271
Cdd:cd11386  90 EAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTE----EAVEA---MEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 91783857 272 HLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSS 309
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
76-334 1.51e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 127.40  E-value: 1.51e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857     76 DVSGHVEEVAARVQRQAHVCRALRESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIE 155
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    156 SQIGALRSALAHVSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQT 235
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    236 EQLISEGSANTARAHRVREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSSENFAQA 315
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*....
gi 91783857    316 KDRLGNLLDVSETLIELTA 334
Cdd:smart00283 241 SAAAEELSGLAEELDELVE 259
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
57-334 6.07e-31

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 122.79  E-value: 6.07e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  57 QTVVGDIAAQAGKLGIEICDVSGHVEEVAARVQRQAhvcralrESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQT 136
Cdd:COG0840 130 RQIIDAVQDNAEALSGASEEIAASATELSARADQQA-------ESLEEVASAIEELSETVKEVAFNAKEAAALASEASQV 202
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 137 LEASLADIHGLVEGVTVIESQIGALRSALAHVSRVSEE----ISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKT 212
Cdd:COG0840 203 AEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEitsvINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRK 282
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 213 LSAKTAQATGQIETTLSQLTQQTEQLISEGSANTARAHRVREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCD 292
Cdd:COG0840 283 LAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLE 362
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 91783857 293 GLEAQVLEMASGVEDSSENFAQAKDRLGNLLDVSETLIELTA 334
Cdd:COG0840 363 EINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVA 404
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
124-336 2.00e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 97.90  E-value: 2.00e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   124 AEAATGVQQSQQTLEASLADIHGLVEGVtviESQIGALRSALAHVSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSF 203
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDA---VETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGF 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   204 AVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEQliSEGSANTARAhRVREGTRKIGDvvhaTGDAIAHLNNEAGQIALL 283
Cdd:pfam00015  78 AVVADEVRKLAERSAQAAKEIEALIEEIVKQTND--STASIQQTRT-EVEVGSTIVES----TGEALKEIVDAVAEIADI 150
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 91783857   284 TGEIETQCDGLEAQVLEMASGVED----SSENFAQAKDRLGNLLDVSETLIELTAAT 336
Cdd:pfam00015 151 VQEIAAASDEQSAGIDQVNQAVARidqvTQQNAALVEESAAAAETLEEQAEELTASV 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
83-322 2.74e-15

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 76.97  E-value: 2.74e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   83 EVAARVQRQAhvcRALRESAAhtlagnhriaAAAREMSHVSAEAATGVQQSQQTLEASLADIHG--LVEGVTVIESQIGA 160
Cdd:PRK15048 288 DLSSRTEQQA---SALEETAA----------SMEQLTATVKQNADNARQASQLAQSASDTAQHGgkVVDGVVKTMHEIAD 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  161 LRSALAHVSRVseeISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETtlsqLTQQTEQLIS 240
Cdd:PRK15048 355 SSKKIADIISV---IDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKA----LIEDSVSRVD 427
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  241 EGSANTARAhrvregtrkiGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEM-------ASGVEDSSENFA 313
Cdd:PRK15048 428 TGSVLVESA----------GETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMdrvtqqnASLVQESAAAAA 497

                 ....*....
gi 91783857  314 QAKDRLGNL 322
Cdd:PRK15048 498 ALEEQASRL 506
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
111-377 1.86e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 42.74  E-value: 1.86e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    111 RIAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIESQIGALRsalAHVSRVSEEISLIARQTHLLALNAA 190
Cdd:TIGR02168  688 ELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLE---AEVEQLEERIAQLSKELTELEAEIE 764
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    191 IEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEQLisegSANTARAHRVREGTRKIGDVVHATGDAI 270
Cdd:TIGR02168  765 ELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAEL----TLLNEEAANLRERLESLERRIAATERRL 840
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    271 AHLNNEA----GQIALLTGEIE---TQCDGLEAQVLEMASGVEDSSENFAQAKDRLGNLldvSETLIELtaatgvETADT 343
Cdd:TIGR02168  841 EDLEEQIeelsEDIESLAAEIEeleELIEELESELEALLNERASLEEALALLRSELEEL---SEELREL------ESKRS 911
                          250       260       270
                   ....*....|....*....|....*....|....
gi 91783857    344 RFIEAVQKAAAAVSKaFETAVARGEVSIEDLFDQ 377
Cdd:TIGR02168  912 ELRRELEELREKLAQ-LELRLEGLEVRIDNLQER 944
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
112-309 4.83e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 118.49  E-value: 4.83e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 112 IAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIESQIGALRSALAHVSRVSEEISLIARQTHLLALNAAI 191
Cdd:cd11386  10 VAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNLLALNAAI 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 192 EAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEqlisEGSANtarAHRVREGTRKIGDVVHATGDAIA 271
Cdd:cd11386  90 EAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTE----EAVEA---MEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 91783857 272 HLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSS 309
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
76-334 1.51e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 127.40  E-value: 1.51e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857     76 DVSGHVEEVAARVQRQAHVCRALRESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIE 155
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    156 SQIGALRSALAHVSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQT 235
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    236 EQLISEGSANTARAHRVREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSSENFAQA 315
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*....
gi 91783857    316 KDRLGNLLDVSETLIELTA 334
Cdd:smart00283 241 SAAAEELSGLAEELDELVE 259
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
57-334 6.07e-31

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 122.79  E-value: 6.07e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  57 QTVVGDIAAQAGKLGIEICDVSGHVEEVAARVQRQAhvcralrESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQT 136
Cdd:COG0840 130 RQIIDAVQDNAEALSGASEEIAASATELSARADQQA-------ESLEEVASAIEELSETVKEVAFNAKEAAALASEASQV 202
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 137 LEASLADIHGLVEGVTVIESQIGALRSALAHVSRVSEE----ISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKT 212
Cdd:COG0840 203 AEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEitsvINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRK 282
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 213 LSAKTAQATGQIETTLSQLTQQTEQLISEGSANTARAHRVREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCD 292
Cdd:COG0840 283 LAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLE 362
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 91783857 293 GLEAQVLEMASGVEDSSENFAQAKDRLGNLLDVSETLIELTA 334
Cdd:COG0840 363 EINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVA 404
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
124-336 2.00e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 97.90  E-value: 2.00e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   124 AEAATGVQQSQQTLEASLADIHGLVEGVtviESQIGALRSALAHVSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSF 203
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDA---VETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGF 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   204 AVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEQliSEGSANTARAhRVREGTRKIGDvvhaTGDAIAHLNNEAGQIALL 283
Cdd:pfam00015  78 AVVADEVRKLAERSAQAAKEIEALIEEIVKQTND--STASIQQTRT-EVEVGSTIVES----TGEALKEIVDAVAEIADI 150
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 91783857   284 TGEIETQCDGLEAQVLEMASGVED----SSENFAQAKDRLGNLLDVSETLIELTAAT 336
Cdd:pfam00015 151 VQEIAAASDEQSAGIDQVNQAVARidqvTQQNAALVEESAAAAETLEEQAEELTASV 207
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
83-322 2.74e-15

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 76.97  E-value: 2.74e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   83 EVAARVQRQAhvcRALRESAAhtlagnhriaAAAREMSHVSAEAATGVQQSQQTLEASLADIHG--LVEGVTVIESQIGA 160
Cdd:PRK15048 288 DLSSRTEQQA---SALEETAA----------SMEQLTATVKQNADNARQASQLAQSASDTAQHGgkVVDGVVKTMHEIAD 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  161 LRSALAHVSRVseeISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETtlsqLTQQTEQLIS 240
Cdd:PRK15048 355 SSKKIADIISV---IDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKA----LIEDSVSRVD 427
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  241 EGSANTARAhrvregtrkiGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEM-------ASGVEDSSENFA 313
Cdd:PRK15048 428 TGSVLVESA----------GETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMdrvtqqnASLVQESAAAAA 497

                 ....*....
gi 91783857  314 QAKDRLGNL 322
Cdd:PRK15048 498 ALEEQASRL 506
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
76-368 8.98e-15

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 75.38  E-value: 8.98e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   76 DVSGHVEEVAARVQRQAhvcrALRESAAHTLAGNhriAAAAREMSHVSAEAATGVQQsqqtleasladihglveGVTVIE 155
Cdd:PRK15041 290 DLSSRTEQQAASLEETA----ASMEQLTATVKQN---AENARQASHLALSASETAQR-----------------GGKVVD 345
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  156 SQIGALRSALAHVSRVSEEISLI---ARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLsqlt 232
Cdd:PRK15041 346 NVVQTMRDISTSSQKIADIISVIdgiAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLI---- 421
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  233 qqteqlisEGSANtarahRVREGTrkigDVVHATGDAIAHLNNEAGQIALLTGEIETQCD----GLEAQVLEMASGVEDS 308
Cdd:PRK15041 422 --------EDSVG-----KVDVGS----TLVESAGETMAEIVSAVTRVTDIMGEIASASDeqsrGIDQVGLAVAEMDRVT 484
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 91783857  309 SENFAQAKDRLGNLLDVSETLIELTAATGV-----ETADTRFIEAVQKAAAAVSKAfETAVARGE 368
Cdd:PRK15041 485 QQNAALVEESAAAAAALEEQASRLTEAVAVfriqqQQQQQRETSAVVKTVTPATPR-KMAVADSG 548
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
76-356 1.08e-13

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 72.03  E-value: 1.08e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857   76 DVSGHVEEVAARVQRQAhvcrALRESAAHTLAGNhriAAAAREMSHVSAEAAT-----GVQQSqqTLEASLADIhglveg 150
Cdd:PRK09793 286 DLSSRTEQQAASLAQTA----ASMEQLTATVGQN---ADNARQASELAKNAATtaqagGVQVS--TMTHTMQEI------ 350
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  151 vTVIESQIGALRSAlahvsrvseeISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETtlsq 230
Cdd:PRK09793 351 -ATSSQKIGDIISV----------IDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKG---- 415
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857  231 LTQQTEQLISEGSAntarahRVREGTRKIGDVVhatgDAIAHLNNEAGQIALLTGEIETQCDGLEAQVLEMASGVEDSS- 309
Cdd:PRK09793 416 LIEESVNRVQQGSK------LVNNAAATMTDIV----SSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNAs 485
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 91783857  310 --ENFAQAKDRLGNLLDvseTLIELTAATGVETADTRFIEAVQKAAAAV 356
Cdd:PRK09793 486 lvEEAAVATEQLANQAD---HLSSRVAVFTLEEHEVARHESAQLQIAPV 531
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
111-377 1.86e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 42.74  E-value: 1.86e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    111 RIAAAAREMSHVSAEAATGVQQSQQTLEASLADIHGLVEGVTVIESQIGALRsalAHVSRVSEEISLIARQTHLLALNAA 190
Cdd:TIGR02168  688 ELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLE---AEVEQLEERIAQLSKELTELEAEIE 764
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    191 IEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQQTEQLisegSANTARAHRVREGTRKIGDVVHATGDAI 270
Cdd:TIGR02168  765 ELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAEL----TLLNEEAANLRERLESLERRIAATERRL 840
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    271 AHLNNEA----GQIALLTGEIE---TQCDGLEAQVLEMASGVEDSSENFAQAKDRLGNLldvSETLIELtaatgvETADT 343
Cdd:TIGR02168  841 EDLEEQIeelsEDIESLAAEIEeleELIEELESELEALLNERASLEEALALLRSELEEL---SEELREL------ESKRS 911
                          250       260       270
                   ....*....|....*....|....*....|....
gi 91783857    344 RFIEAVQKAAAAVSKaFETAVARGEVSIEDLFDQ 377
Cdd:TIGR02168  912 ELRRELEELREKLAQ-LELRLEGLEVRIDNLQER 944
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
65-324 2.01e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 42.74  E-value: 2.01e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857     65 AQAGKLGIEICDVSGHVEEVAARVQRQAHVCRALRESAAHTLAGNHRIAAAAREMSHVSAEAATGVQQSQQTLEASLADI 144
Cdd:TIGR02168  715 EQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQL 794
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    145 hglvegvtviESQIGALRSALahvSRVSEEISLIARQTHLLALNAAIEAARAGDSGKSFAVVAAEVKTLSAKTAQATGQI 224
Cdd:TIGR02168  795 ----------KEELKALREAL---DELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEI 861
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857    225 ETTLSQLTQQTEQLISE----GSANTARAHR------VREGTRKIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGL 294
Cdd:TIGR02168  862 EELEELIEELESELEALlnerASLEEALALLrseleeLSEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNL 941
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|.
gi 91783857    295 EAQ-----------VLEMASGVEDSSENFAQAKDRLGNLLD 324
Cdd:TIGR02168  942 QERlseeysltleeAEALENKIEDDEEEARRRLKRLENKIK 982
COG4942 COG4942
Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
154-367 9.37e-03

Membrane-bound metallopeptidase [Cell division and chromosome partitioning]


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 37.01  E-value: 9.37e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 154 IESQIGALRSALAHVSRVSEEIsliarQTHLLALNAAIEAARAgdsgkSFAVVAAEVKTLSAKTAQATGQIETTLSQLTQ 233
Cdd:COG4942  43 IQKEIAALEKKIREQQDQRAKL-----EKQLKSLETEIASLEA-----QLIETADDLKKLRKQIADLNARLNALEVQERE 112
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 234 QTEQL-----------ISEGSANTARAHRVREGTR---KIGDVVHATGDAIAHLNNEAGQIALLTGEIETQCDGLEAQVL 299
Cdd:COG4942 113 QRRRLaeqlaalqrsgRNPPPALLVSPEDAQRSVRlaiYYGALNPARAERIDALKATLKQLAAVRAEIAAEQAELTTLLS 192
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783857 300 EMA------------------------SGVEDSSENFAQAKDRLGNLLdvseTLIELTAATGVETADTRFIEAVQKAAAA 355
Cdd:COG4942 193 EQRaqqaklaqlleerkktlaqlnselSADQKKLEELRANESRLKNEI----ASAEAAAAKAREAAAAAEAAAARARAAE 268
                       250
                ....*....|..
gi 91783857 356 VSKAFETAVARG 367
Cdd:COG4942 269 AKRTGETYKPTA 280
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH