NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|91783605|ref|YP_558811|]
View 

methyl-accepting chemotaxis sensory transducer [Burkholderia xenovorans LB400]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PilJ pfam13675
Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type ...
26-133 2.85e-09

Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type IV pili methyl-accepting chemotaxis transducer proteins where there is also a HAMP, signature towards the C-terminus.


:

Pssm-ID: 257980  Cd Length: 100  Bit Score: 51.69  E-value: 2.85e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605    26 INMAGRQRMLSQRIVLKAMLAFQQFDGALAIA--RDTLNTFADSHTALTQGRDGLPglfsPALRDAFHgsgQVAAKITEF 103
Cdd:pfam13675   6 INVAGSLRMQSQRLAKAVLLAALGPDDAQAFAqlEQSIDSFERNLAALRRGDPPRP----PEVQAQLA---QLRALWQEL 78
                          90       100       110
                  ....*....|....*....|....*....|
gi 91783605   104 IALASAAleaigrasPRADDALKALVDSVD 133
Cdd:pfam13675  79 RPLLEAA--------ATAEAAVADLVRQSD 100
MCP_signal super family cl21547
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
95-200 1.80e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 36.83  E-value: 1.80e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  95 QVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLThlhgVTAVYEQESRRIARLQKKEQQ--QLIERIKAIA 172
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQ----IDESVDEAVSAVEELEESSAEigEIVEVIDDIA 77
                        90       100
                ....*....|....*....|....*...
gi 91783605 173 KEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:cd11386  78 EQTNLLALNAAIEAARAGEAGRGFAVVA 105
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
94-200 5.41e-03

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 36.12  E-value: 5.41e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  94 GQVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLTHLHGVTAVYEQESRRIARLQKKEQQ--QLIERIKAI 171
Cdd:COG0840 169 EEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieEITSVINSI 248
                        90       100
                ....*....|....*....|....*....
gi 91783605 172 AKEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:COG0840 249 AEQTNLLALNAAIEAARAGEAGRGFAVVA 277
 
Name Accession Description Interval E-value
PilJ pfam13675
Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type ...
26-133 2.85e-09

Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type IV pili methyl-accepting chemotaxis transducer proteins where there is also a HAMP, signature towards the C-terminus.


Pssm-ID: 257980  Cd Length: 100  Bit Score: 51.69  E-value: 2.85e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605    26 INMAGRQRMLSQRIVLKAMLAFQQFDGALAIA--RDTLNTFADSHTALTQGRDGLPglfsPALRDAFHgsgQVAAKITEF 103
Cdd:pfam13675   6 INVAGSLRMQSQRLAKAVLLAALGPDDAQAFAqlEQSIDSFERNLAALRRGDPPRP----PEVQAQLA---QLRALWQEL 78
                          90       100       110
                  ....*....|....*....|....*....|
gi 91783605   104 IALASAAleaigrasPRADDALKALVDSVD 133
Cdd:pfam13675  79 RPLLEAA--------ATAEAAVADLVRQSD 100
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
95-200 1.80e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 36.83  E-value: 1.80e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  95 QVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLThlhgVTAVYEQESRRIARLQKKEQQ--QLIERIKAIA 172
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQ----IDESVDEAVSAVEELEESSAEigEIVEVIDDIA 77
                        90       100
                ....*....|....*....|....*...
gi 91783605 173 KEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:cd11386  78 EQTNLLALNAAIEAARAGEAGRGFAVVA 105
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
94-200 5.41e-03

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 36.12  E-value: 5.41e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  94 GQVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLTHLHGVTAVYEQESRRIARLQKKEQQ--QLIERIKAI 171
Cdd:COG0840 169 EEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieEITSVINSI 248
                        90       100
                ....*....|....*....|....*....
gi 91783605 172 AKEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:COG0840 249 AEQTNLLALNAAIEAARAGEAGRGFAVVA 277
 
Name Accession Description Interval E-value
PilJ pfam13675
Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type ...
26-133 2.85e-09

Type IV pili methyl-accepting chemotaxis transducer N-term; This domain is found on many type IV pili methyl-accepting chemotaxis transducer proteins where there is also a HAMP, signature towards the C-terminus.


Pssm-ID: 257980  Cd Length: 100  Bit Score: 51.69  E-value: 2.85e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605    26 INMAGRQRMLSQRIVLKAMLAFQQFDGALAIA--RDTLNTFADSHTALTQGRDGLPglfsPALRDAFHgsgQVAAKITEF 103
Cdd:pfam13675   6 INVAGSLRMQSQRLAKAVLLAALGPDDAQAFAqlEQSIDSFERNLAALRRGDPPRP----PEVQAQLA---QLRALWQEL 78
                          90       100       110
                  ....*....|....*....|....*....|
gi 91783605   104 IALASAAleaigrasPRADDALKALVDSVD 133
Cdd:pfam13675  79 RPLLEAA--------ATAEAAVADLVRQSD 100
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
95-200 1.80e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 36.83  E-value: 1.80e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  95 QVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLThlhgVTAVYEQESRRIARLQKKEQQ--QLIERIKAIA 172
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQ----IDESVDEAVSAVEELEESSAEigEIVEVIDDIA 77
                        90       100
                ....*....|....*....|....*...
gi 91783605 173 KEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:cd11386  78 EQTNLLALNAAIEAARAGEAGRGFAVVA 105
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
94-200 5.41e-03

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 36.12  E-value: 5.41e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 91783605  94 GQVAAKITEFIALASAALEAIGRASPRADDALKALVDSVDPLLTHLHGVTAVYEQESRRIARLQKKEQQ--QLIERIKAI 171
Cdd:COG0840 169 EEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEieEITSVINSI 248
                        90       100
                ....*....|....*....|....*....
gi 91783605 172 AKEAHIVSFNGQIVASRAHVTGREFAVVA 200
Cdd:COG0840 249 AEQTNLLALNAAIEAARAGEAGRGFAVVA 277
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH