NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|89055851|ref|YP_511302|]
View 

methyl-accepting chemotaxis sensory transducer [Jannaschia sp. CCS1]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
373-572 1.92e-52

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 180.13  E-value: 1.92e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 373 ESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQT 452
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 453 NLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSL 532
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 89055851 533 VSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEETS 572
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
200-269 1.76e-04

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.76e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   200 LLVTLGILTVMVLVAFFSIRNMLAPLTHVARSLGKLSEGTLDEDIGHQnRNDEIGKISKAMVVLQESMQT 269
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
Tar_Tsr_LBD super family cl00144
ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate ...
5-41 1.42e-03

ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate and repellents) and Tsr (taxis to serine and repellents) are homologous chemoreceptors that have a high specificity for aspartate and serine, respectively. Both are homodimeric receptors and contain an N-terminal periplasmic ligand binding domain, a transmembrane region, a HAMP domain and a C-terminal cytosolic signaling domain.


The actual alignment was detected with superfamily member pfam12729:

Pssm-ID: 260214  Cd Length: 181  Bit Score: 38.75  E-value: 1.42e-03
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 89055851     5 NMTLKTKLIVTIAAMLILLA--GVLGYLGTQKIQAALNE 41
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIivGIVGLYSLKKINKNSET 39
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
346-593 1.33e-69

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 228.71  E-value: 1.33e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    346 AIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAI 425
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    426 KAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIA------ 499
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    500 --------SSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEET 571
Cdd:smart00283 161 neavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 89055851    572 SAASEGLTNAADRLASHLARFK 593
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
373-572 1.92e-52

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 180.13  E-value: 1.92e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 373 ESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQT 452
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 453 NLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSL 532
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 89055851 533 VSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEETS 572
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
200-269 1.76e-04

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.76e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   200 LLVTLGILTVMVLVAFFSIRNMLAPLTHVARSLGKLSEGTLDEDIGHQnRNDEIGKISKAMVVLQESMQT 269
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
5-41 1.42e-03

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 38.75  E-value: 1.42e-03
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 89055851     5 NMTLKTKLIVTIAAMLILLA--GVLGYLGTQKIQAALNE 41
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIivGIVGLYSLKKINKNSET 39
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
346-593 1.33e-69

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 228.71  E-value: 1.33e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    346 AIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAI 425
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    426 KAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIA------ 499
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    500 --------SSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEET 571
Cdd:smart00283 161 neavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 89055851    572 SAASEGLTNAADRLASHLARFK 593
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
328-594 1.36e-68

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 234.90  E-value: 1.36e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  328 ELRTSYNMLLDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTT 407
Cdd:PRK15048 249 DLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLA 328
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  408 QENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHS 487
Cdd:PRK15048 329 QSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS 408
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  488 SASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAM 567
Cdd:PRK15048 409 AQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASL 488
                        250       260
                 ....*....|....*....|....*..
gi 89055851  568 AEETSAASEGLTNAADRLASHLARFKL 594
Cdd:PRK15048 489 VQESAAAAAALEEQASRLTQAVSAFRL 515
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
248-594 6.26e-61

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 210.23  E-value: 6.26e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 248 NRNDEIGKISKAMVVLQESMQTAEELKAADVERSTIVAAKQQEQDIVVTALTQGLSRLGNLDLTQQIEntpeAPFPADYE 327
Cdd:COG0840  41 NLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRID----ESSNDEFG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 328 ELRTSYNMLLDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTT 407
Cdd:COG0840 117 QLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALA 196
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 408 QENRTNAKRTGEIVDTAIKAMSAIE-----------ESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVV 476
Cdd:COG0840 197 SEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVV 276
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 477 ASEVRALAQHSSASAQEIKGLIAS--------------SSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKE 542
Cdd:COG0840 277 ADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEE 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 89055851 543 QSIGVTEINAAVRDLDTATQGNAAMAEETSAASEGLTNAADRLASHLARFKL 594
Cdd:COG0840 357 QTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
398-594 4.49e-53

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 182.26  E-value: 4.49e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   398 ANASD-AETTTQENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVV 476
Cdd:pfam00015   1 AQASDlAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   477 ASEVRALAQHSSASAQEIKGLIASS--------------SDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKE 542
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEIvkqtndstasiqqtRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 89055851   543 QSIGVTEINAAVRDLDTATQGNAAMAEETSAASEGLTNAADRLASHLARFKL 594
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
CitA COG3290
Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction ...
142-222 1.54e-04

Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]


Pssm-ID: 225827 [Multi-domain]  Cd Length: 537  Bit Score: 43.43  E-value: 1.54e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 142 DALINGEtfSGAAEVRGHLFRAL--YVPVFDGTGAIVGAFAVGRPIETLTAMI---RQNMIETLLVTLGI-LTVMVLVAF 215
Cdd:COG3290 119 EAALAGE--SYVSTAKGSLGKSLraKVPIFDEDGKQIGVVSVGYLLSEIDDVIlefLRPLALIVVLGLLIgLLGAWILAR 196

                ....*..
gi 89055851 216 FSIRNML 222
Cdd:COG3290 197 HIKRQML 203
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
373-572 1.92e-52

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 180.13  E-value: 1.92e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 373 ESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQT 452
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 453 NLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSL 532
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 89055851 533 VSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEETS 572
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
200-269 1.76e-04

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 40.29  E-value: 1.76e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   200 LLVTLGILTVMVLVAFFSIRNMLAPLTHVARSLGKLSEGTLDEDIGHQnRNDEIGKISKAMVVLQESMQT 269
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS-GPDEIGELARAFNQMADRLRE 70
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
5-41 1.42e-03

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 38.75  E-value: 1.42e-03
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 89055851     5 NMTLKTKLIVTIAAMLILLA--GVLGYLGTQKIQAALNE 41
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIivGIVGLYSLKKINKNSET 39
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
346-593 1.33e-69

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 228.71  E-value: 1.33e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    346 AIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGEIVDTAI 425
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    426 KAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIA------ 499
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851    500 --------SSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEET 571
Cdd:smart00283 161 neavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 89055851    572 SAASEGLTNAADRLASHLARFK 593
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
328-594 1.36e-68

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 234.90  E-value: 1.36e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  328 ELRTSYNMLLDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTT 407
Cdd:PRK15048 249 DLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLA 328
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  408 QENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHS 487
Cdd:PRK15048 329 QSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRS 408
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  488 SASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAM 567
Cdd:PRK15048 409 AQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASL 488
                        250       260
                 ....*....|....*....|....*..
gi 89055851  568 AEETSAASEGLTNAADRLASHLARFKL 594
Cdd:PRK15048 489 VQESAAAAAALEEQASRLTQAVSAFRL 515
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
328-594 6.37e-66

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 227.91  E-value: 6.37e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  328 ELRTSYNMLLDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTT 407
Cdd:PRK15041 251 QLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLA 330
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  408 QENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHS 487
Cdd:PRK15041 331 LSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRS 410
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  488 SASAQEIKGLIASSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAM 567
Cdd:PRK15041 411 AQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAAL 490
                        250       260
                 ....*....|....*....|....*..
gi 89055851  568 AEETSAASEGLTNAADRLASHLARFKL 594
Cdd:PRK15041 491 VEESAAAAAALEEQASRLTEAVAVFRI 517
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
340-594 4.01e-63

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 219.56  E-value: 4.01e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  340 LSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAKRTGE 419
Cdd:PRK09793 259 LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGV 338
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  420 IVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQHSSASAQEIKGLIA 499
Cdd:PRK09793 339 QVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE 418
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  500 SSSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEETSAASEGLT 579
Cdd:PRK09793 419 ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLA 498
                        250
                 ....*....|....*
gi 89055851  580 NAADRLASHLARFKL 594
Cdd:PRK09793 499 NQADHLSSRVAVFTL 513
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
248-594 6.26e-61

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 210.23  E-value: 6.26e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 248 NRNDEIGKISKAMVVLQESMQTAEELKAADVERSTIVAAKQQEQDIVVTALTQGLSRLGNLDLTQQIEntpeAPFPADYE 327
Cdd:COG0840  41 NLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRID----ESSNDEFG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 328 ELRTSYNMLLDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTT 407
Cdd:COG0840 117 QLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALA 196
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 408 QENRTNAKRTGEIVDTAIKAMSAIE-----------ESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVV 476
Cdd:COG0840 197 SEASQVAEEGGEEVRQAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVV 276
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 477 ASEVRALAQHSSASAQEIKGLIAS--------------SSDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKE 542
Cdd:COG0840 277 ADEVRKLAERSADSAKEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEE 356
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|..
gi 89055851 543 QSIGVTEINAAVRDLDTATQGNAAMAEETSAASEGLTNAADRLASHLARFKL 594
Cdd:COG0840 357 QTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
398-594 4.49e-53

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 182.26  E-value: 4.49e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   398 ANASD-AETTTQENRTNAKRTGEIVDTAIKAMSAIEESSKKITQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVV 476
Cdd:pfam00015   1 AQASDlAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851   477 ASEVRALAQHSSASAQEIKGLIASS--------------SDHVDNGSKLVHDAGRSINDIIDRVDRVTSLVSDIAVSAKE 542
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEIvkqtndstasiqqtRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 89055851   543 QSIGVTEINAAVRDLDTATQGNAAMAEETSAASEGLTNAADRLASHLARFKL 594
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
CitA COG3290
Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction ...
142-222 1.54e-04

Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]


Pssm-ID: 225827 [Multi-domain]  Cd Length: 537  Bit Score: 43.43  E-value: 1.54e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851 142 DALINGEtfSGAAEVRGHLFRAL--YVPVFDGTGAIVGAFAVGRPIETLTAMI---RQNMIETLLVTLGI-LTVMVLVAF 215
Cdd:COG3290 119 EAALAGE--SYVSTAKGSLGKSLraKVPIFDEDGKQIGVVSVGYLLSEIDDVIlefLRPLALIVVLGLLIgLLGAWILAR 196

                ....*..
gi 89055851 216 FSIRNML 222
Cdd:COG3290 197 HIKRQML 203
PRK02224 PRK02224
chromosome segregation protein; Provisional
264-576 7.12e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 41.56  E-value: 7.12e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  264 QESMQTAEELKAADVERSTIVAAKQQEQDIVvTALTQGLSRLGNL-----DLTQQIENTpEAPFPADYEELRTSYNMLLD 338
Cdd:PRK02224 213 SELAELDEEIERYEEQREQARETRDEADEVL-EEHEERREELETLeaeieDLRETIAET-EREREELAEEVRDLRERLEE 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  339 nLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQENRTNAkrtG 418
Cdd:PRK02224 291 -LEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEA---A 366
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  419 EIVDTAIKAMSAIEESSKKITQIISVIDDI-------------------AFQTNLLALNAGV---------------EAA 464
Cdd:PRK02224 367 ELESELEEAREAVEDRREEIEELEEEIEELrerfgdapvdlgnaedfleELREERDELREREaeleatlrtarerveEAE 446
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89055851  465 RAGEAGR-----------GFAVVASEVRALAQHSSASAQEIKGLIASSSDHVDNGSKLVhDAGRSINDIIDRVDRVTSLV 533
Cdd:PRK02224 447 ALLEAGKcpecgqpvegsPHVETIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLV-EAEDRIERLEERREDLEELI 525
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
gi 89055851  534 SDIAVSAKEQSIGVTEINAAVRDLDTATQGNAAMAEETSAASE 576
Cdd:PRK02224 526 AERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAE 568
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
337-409 1.60e-03

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 39.58  E-value: 1.60e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 89055851    337 LDNLSESVEAIRDVATEVSHDAREMAEASSDLSSRTESQAATLEQSAAALEEMSASVLSTAANASDAETTTQE 409
Cdd:smart00283 188 LEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISAAAEELSGLAEELDELVER 260
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH