NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|86741935|ref|YP_482335|]
View 

serine phosphatase [Frankia sp. CcI3]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
54-253 2.77e-34

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 124.71  E-value: 2.77e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    54 GAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRtMNDIAGPGDIGEMFATAFLAVVDARSGQVVYVN 133
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLER-LNRALQRNLEGERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935   134 AGHPPALHLpgSAAGGgscAREPrsLGPTGPILSdLFAGSEiWSSRSLTMDVGDRLLLYTDGISEARDAHGTQFGTESL- 212
Cdd:pfam07228  80 AGHPPPLLL--RPDGG---VVEL--LESPGLPLG-VLPDAP-YETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLl 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 86741935   213 -SAGRIGTDSPDTLLDRLFAQLAIHAHGVDGDDRTMAILARD 253
Cdd:pfam07228 151 aLLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
54-253 2.77e-34

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 124.71  E-value: 2.77e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    54 GAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRtMNDIAGPGDIGEMFATAFLAVVDARSGQVVYVN 133
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLER-LNRALQRNLEGERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935   134 AGHPPALHLpgSAAGGgscAREPrsLGPTGPILSdLFAGSEiWSSRSLTMDVGDRLLLYTDGISEARDAHGTQFGTESL- 212
Cdd:pfam07228  80 AGHPPPLLL--RPDGG---VVEL--LESPGLPLG-VLPDAP-YETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLl 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 86741935   213 -SAGRIGTDSPDTLLDRLFAQLAIHAHGVDGDDRTMAILARD 253
Cdd:pfam07228 151 aLLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
36-200 3.42e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 102.81  E-value: 3.42e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935     36 SHPATPGS--SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRTMNDIAGPGDiGEM 113
Cdd:smart00331   7 AQYYEDATqvGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGE-DGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    114 FATAFLAVVDARSGQVVYVNAGHPPALHLpgsAAGGGSCAREPRSLGPTGpILSDLFAgseiwSSRSLTMDVGDRLLLYT 193
Cdd:smart00331  86 FATLFLALYDFAGGTLSYANAGHSPPYLL---RADGGLVEDLDDLGAPLG-LEPDVEV-----DVRELTLEPGDLLLLYT 156

                   ....*..
gi 86741935    194 DGISEAR 200
Cdd:smart00331 157 DGLTEAR 163
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
44-253 1.21e-22

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 95.16  E-value: 1.21e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935  44 SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRTMNDIAGPGDIGEMFATAFLAVVD 123
Cdd:COG2208 162 GGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDPADVLETLNRVLKQNLEEDMFVTLFLGVYD 241
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935 124 ARSGQVVYVNAGHPPALHLpgsAAGGGSCAREPRSLGPTGPILSDlfagsEIWSSRSLTMDVGDRLLLYTDGISEARDAH 203
Cdd:COG2208 242 LDSGELTYSNAGHEPALIL---SADGEIEVEDLTALGLPIGLLPD-----YQYEVASLQLEPGDLLVLYTDGVTEARNSD 313
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 86741935 204 GTQFGTESL--SAGRIGTDSPDTLLDRLFAQLAIHA--HGVDgDDRTMAILARD 253
Cdd:COG2208 314 GEFFGLERLlkILGRLLGQPAEEILEAILESLEELQgdQIQD-DDITLLVLKVK 366
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
44-138 1.87e-06

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 47.76  E-value: 1.87e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    44 SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMhRTMNDIAGPGDIGEMFATAFLAVVD 123
Cdd:TIGR02865 567 SGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAI-KTVNSILSLRSTDEKFSTLDLSVID 645
                          90
                  ....*....|....*
gi 86741935   124 ARSGQVVYVNAGHPP 138
Cdd:TIGR02865 646 LYTGQAEFVKVGAVP 660
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
54-253 2.77e-34

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 124.71  E-value: 2.77e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    54 GAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRtMNDIAGPGDIGEMFATAFLAVVDARSGQVVYVN 133
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLER-LNRALQRNLEGERFATAVLAVYDPETGTLEYAN 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935   134 AGHPPALHLpgSAAGGgscAREPrsLGPTGPILSdLFAGSEiWSSRSLTMDVGDRLLLYTDGISEARDAHGTQFGTESL- 212
Cdd:pfam07228  80 AGHPPPLLL--RPDGG---VVEL--LESPGLPLG-VLPDAP-YETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLl 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 86741935   213 -SAGRIGTDSPDTLLDRLFAQLAIHAHGVDGDDRTMAILARD 253
Cdd:pfam07228 151 aLLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
36-200 3.42e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 102.81  E-value: 3.42e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935     36 SHPATPGS--SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRTMNDIAGPGDiGEM 113
Cdd:smart00331   7 AQYYEDATqvGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGE-DGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    114 FATAFLAVVDARSGQVVYVNAGHPPALHLpgsAAGGGSCAREPRSLGPTGpILSDLFAgseiwSSRSLTMDVGDRLLLYT 193
Cdd:smart00331  86 FATLFLALYDFAGGTLSYANAGHSPPYLL---RADGGLVEDLDDLGAPLG-LEPDVEV-----DVRELTLEPGDLLLLYT 156

                   ....*..
gi 86741935    194 DGISEAR 200
Cdd:smart00331 157 DGLTEAR 163
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
44-253 1.21e-22

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 95.16  E-value: 1.21e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935  44 SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMHRTMNDIAGPGDIGEMFATAFLAVVD 123
Cdd:COG2208 162 GGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDPADVLETLNRVLKQNLEEDMFVTLFLGVYD 241
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935 124 ARSGQVVYVNAGHPPALHLpgsAAGGGSCAREPRSLGPTGPILSDlfagsEIWSSRSLTMDVGDRLLLYTDGISEARDAH 203
Cdd:COG2208 242 LDSGELTYSNAGHEPALIL---SADGEIEVEDLTALGLPIGLLPD-----YQYEVASLQLEPGDLLVLYTDGVTEARNSD 313
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 86741935 204 GTQFGTESL--SAGRIGTDSPDTLLDRLFAQLAIHA--HGVDgDDRTMAILARD 253
Cdd:COG2208 314 GEFFGLERLlkILGRLLGQPAEEILEAILESLEELQgdQIQD-DDITLLVLKVK 366
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
44-138 1.87e-06

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 47.76  E-value: 1.87e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741935    44 SGDWVEVVDIGAGRLAICVGDAAGHGEQAARFARRFREAMRRHLLAGEEPEATMhRTMNDIAGPGDIGEMFATAFLAVVD 123
Cdd:TIGR02865 567 SGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAI-KTVNSILSLRSTDEKFSTLDLSVID 645
                          90
                  ....*....|....*
gi 86741935   124 ARSGQVVYVNAGHPP 138
Cdd:TIGR02865 646 LYTGQAEFVKVGAVP 660
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH