NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|86359111|ref|YP_471003|]
View 

methyl-accepting chemotaxis protein [Rhizobium etli CFN 42]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
210-256 2.58e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


:

Pssm-ID: 100122  Cd Length: 48  Bit Score: 42.24  E-value: 2.58e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 86359111 210 ISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLR 256
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLR 47
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
274-480 8.41e-34

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 126.97  E-value: 8.41e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 274 QELSASSEQVSQgateqaasaeeasaSMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK---- 349
Cdd:cd11386   1 EELSASIEEVAA--------------SADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaei 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 350 ---ISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKAAADAGEMLGRLVPD 426
Cdd:cd11386  67 geiVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 86359111 427 IRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELA 480
Cdd:cd11386 147 VEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Tar_Tsr_LBD super family cl00144
ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate ...
2-181 3.31e-06

ligand binding domain of Tar- and Tsr-related chemoreceptors; E.coli Tar (taxis to aspartate and repellents) and Tsr (taxis to serine and repellents) are homologous chemoreceptors that have a high specificity for aspartate and serine, respectively. Both are homodimeric receptors and contain an N-terminal periplasmic ligand binding domain, a transmembrane region, a HAMP domain and a C-terminal cytosolic signaling domain.


The actual alignment was detected with superfamily member pfam12729:

Pssm-ID: 260214  Cd Length: 181  Bit Score: 46.45  E-value: 3.31e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111     2 RLTIKTKLVTAFTFIILMLLGTAAYGIFSLGSLNDTIGNLLAGPAARLDLAQQINIAQLEAIRQQKNLLNARSADEAAAA 81
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    82 IDKGNQARKDFSDAFNQVLALA-TEEGKARWARIAEFSKSFNAADDQIRDYVKTGNAEGANTISITTARAAANGIDSALA 160
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTIlTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDEAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 86359111   161 EILALEKQRMKAADAGADAQY 181
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
133-495 2.24e-46

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 168.63  E-value: 2.24e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 133 KTGNAEGANTISITTARAAANGIDSALAEILALEKQRMKAADAGADAQYETTRTTMIAVAAVALLIAAMTAFWIASTISK 212
Cdd:COG0840   7 LNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 213 GLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQVSQGATEQAA 292
Cdd:COG0840  87 PISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAE 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 293 SAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK------------------ISIVQ 354
Cdd:COG0840 167 SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEElaevvkklsessqeieeiTSVIN 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 355 EIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSM---------------------SSDTVKAA 413
Cdd:COG0840 247 SIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLieeiqneaadavehmeesaseVSEGVKLV 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 414 ADAGEMLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFF 493
Cdd:COG0840 327 EETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406

                ..
gi 86359111 494 KV 495
Cdd:COG0840 407 KL 408
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
210-256 2.58e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 42.24  E-value: 2.58e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 86359111 210 ISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLR 256
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLR 47
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
274-480 8.41e-34

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 126.97  E-value: 8.41e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 274 QELSASSEQVSQgateqaasaeeasaSMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK---- 349
Cdd:cd11386   1 EELSASIEEVAA--------------SADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaei 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 350 ---ISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKAAADAGEMLGRLVPD 426
Cdd:cd11386  67 geiVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 86359111 427 IRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELA 480
Cdd:cd11386 147 VEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
203-256 1.03e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 46.45  E-value: 1.03e-06
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 86359111   203 AFWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLR 256
Cdd:pfam00672  16 AWLLARRLLRPLRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRLR 69
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
2-181 3.31e-06

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 46.45  E-value: 3.31e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111     2 RLTIKTKLVTAFTFIILMLLGTAAYGIFSLGSLNDTIGNLLAGPAARLDLAQQINIAQLEAIRQQKNLLNARSADEAAAA 81
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    82 IDKGNQARKDFSDAFNQVLALA-TEEGKARWARIAEFSKSFNAADDQIRDYVKTGNAEGANTISITTARAAANGIDSALA 160
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTIlTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDEAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 86359111   161 EILALEKQRMKAADAGADAQY 181
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
209-260 1.04e-04

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 40.31  E-value: 1.04e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 86359111    209 TISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVA 260
Cdd:smart00304   2 RLLRPLRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
133-495 2.24e-46

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 168.63  E-value: 2.24e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 133 KTGNAEGANTISITTARAAANGIDSALAEILALEKQRMKAADAGADAQYETTRTTMIAVAAVALLIAAMTAFWIASTISK 212
Cdd:COG0840   7 LNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 213 GLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQVSQGATEQAA 292
Cdd:COG0840  87 PISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAE 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 293 SAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK------------------ISIVQ 354
Cdd:COG0840 167 SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEElaevvkklsessqeieeiTSVIN 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 355 EIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSM---------------------SSDTVKAA 413
Cdd:COG0840 247 SIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLieeiqneaadavehmeesaseVSEGVKLV 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 414 ADAGEMLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFF 493
Cdd:COG0840 327 EETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406

                ..
gi 86359111 494 KV 495
Cdd:COG0840 407 KL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
204-521 1.02e-48

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 178.22  E-value: 1.02e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  204 FWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQV 283
Cdd:PRK15041 212 FGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDL 291
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  284 SQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK-------ISIVQEI 356
Cdd:PRK15041 292 SSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSsqkiadiISVIDGI 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  357 ARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKA-------AADAGEMLGRLVPDIRK 429
Cdd:PRK15041 372 AFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKvdvgstlVESAGETMAEIVSAVTR 451
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  430 TAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKVDTTSS-ARSGAQKM 508
Cdd:PRK15041 452 VTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQQqQRETSAVV 531
                        330
                 ....*....|...
gi 86359111  509 PANGSAKVVKAAA 521
Cdd:PRK15041 532 KTVTPATPRKMAV 544
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
261-494 1.69e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.29  E-value: 1.69e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    261 DAISAAENVSSGSQELSASSEQVSQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAV 340
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    341 DAMRTIALK-------ISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSM-------- 405
Cdd:smart00283  81 SAVEELEESsdeigeiVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLikeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    406 -------------SSDTVKAAADAGEMLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQM 472
Cdd:smart00283 161 neavaameessseVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 86359111    473 SATSEELASQAEELQTSIAFFK 494
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
310-495 2.50e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 120.63  E-value: 2.50e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111   310 QNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALKIS----IVQEIARQTDLLALNAAVEAARAGEHGKGFAVVA 385
Cdd:pfam00015   2 QASDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISdiisVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVA 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111   386 SEVRKLAERSQSAAAEISSMSSDTVK---------------------AAADAGEMLGRLVPDIRKTAELVSEISAACREQ 444
Cdd:pfam00015  82 DEVRKLAERSAQAAKEIEALIEEIVKqtndstasiqqtrtevevgstIVESTGEALKEIVDAVAEIADIVQEIAAASDEQ 161
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 86359111   445 DIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKV 495
Cdd:pfam00015 162 SAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
312-494 1.98e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 39.79  E-value: 1.98e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    312 ADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALKISIVQEIArqTDLLALNAAVEA-ARAGEHGKGFAVVASEVRK 390
Cdd:TIGR02680  795 AAEAERQAESAERELARAARKAAAAAAAWKQARRELERDAADLDLP--TDPDALEAVGLAlKRFGDHLHTLEVAVRELRH 872
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    391 LAERSQSAAAEISSMSSDTVKAAADAGEMLGRL------VPDIRKT-----AELVSEISAACREQDIGAAQINEAIQQLD 459
Cdd:TIGR02680  873 AATRAAEQRARAARAESDAREAAEDAAEARAEAeeaslrLRTLEESvgamvDEIRARLAETRAALASGGRELPRLAEALA 952
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 86359111    460 KVTQQNAGASEQMSATSEELASQAEELQTSIAFFK 494
Cdd:TIGR02680  953 TAEEARGRAEEKRAEADATLDERAEARDHAIGQLR 987
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
210-256 2.58e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 42.24  E-value: 2.58e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 86359111 210 ISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLR 256
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLR 47
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
274-480 8.41e-34

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 126.97  E-value: 8.41e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 274 QELSASSEQVSQgateqaasaeeasaSMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK---- 349
Cdd:cd11386   1 EELSASIEEVAA--------------SADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaei 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 350 ---ISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKAAADAGEMLGRLVPD 426
Cdd:cd11386  67 geiVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....
gi 86359111 427 IRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELA 480
Cdd:cd11386 147 VEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
203-256 1.03e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 46.45  E-value: 1.03e-06
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 86359111   203 AFWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLR 256
Cdd:pfam00672  16 AWLLARRLLRPLRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRLR 69
4HB_MCP_1 pfam12729
Four helix bundle sensory module for signal transduction; This family is a four helix bundle ...
2-181 3.31e-06

Four helix bundle sensory module for signal transduction; This family is a four helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterized in E coli chemoreceptors.


Pssm-ID: 193205  Cd Length: 181  Bit Score: 46.45  E-value: 3.31e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111     2 RLTIKTKLVTAFTFIILMLLGTAAYGIFSLGSLNDTIGNLLAGPAARLDLAQQINIAQLEAIRQQKNLLNARSADEAAAA 81
Cdd:pfam12729   1 NLKIRTKLILLFLLLALLLIIVGIVGLYSLKKINKNSETMYEDRLLPIKWLGEIRSNLREIRANLLELILTTDPAERDEL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    82 IDKGNQARKDFSDAFNQVLALA-TEEGKARWARIAEFSKSFNAADDQIRDYVKTGNAEGANTISITTARAAANGIDSALA 160
Cdd:pfam12729  81 LKDIEELRAEIDKLLKKYEKTIlTEEEKKLFNEFKEQLKAYRKVRNKVLDLAKAGKNDEAYALYLTELEPARDAVIEALD 160
                         170       180
                  ....*....|....*....|.
gi 86359111   161 EILALEKQRMKAADAGADAQY 181
Cdd:pfam12729 161 ELIDYNLKVAKEAYEDNKASY 181
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
209-260 1.04e-04

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 40.31  E-value: 1.04e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 86359111    209 TISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVA 260
Cdd:smart00304   2 RLLRPLRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
133-495 2.24e-46

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 168.63  E-value: 2.24e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 133 KTGNAEGANTISITTARAAANGIDSALAEILALEKQRMKAADAGADAQYETTRTTMIAVAAVALLIAAMTAFWIASTISK 212
Cdd:COG0840   7 LNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 213 GLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQVSQGATEQAA 292
Cdd:COG0840  87 PISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAE 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 293 SAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK------------------ISIVQ 354
Cdd:COG0840 167 SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEElaevvkklsessqeieeiTSVIN 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 355 EIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSM---------------------SSDTVKAA 413
Cdd:COG0840 247 SIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLieeiqneaadavehmeesaseVSEGVKLV 326
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111 414 ADAGEMLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFF 493
Cdd:COG0840 327 EETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406

                ..
gi 86359111 494 KV 495
Cdd:COG0840 407 KL 408
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
204-521 1.02e-48

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 178.22  E-value: 1.02e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  204 FWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQV 283
Cdd:PRK15041 212 FGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDL 291
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  284 SQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK-------ISIVQEI 356
Cdd:PRK15041 292 SSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSsqkiadiISVIDGI 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  357 ARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKA-------AADAGEMLGRLVPDIRK 429
Cdd:PRK15041 372 AFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKvdvgstlVESAGETMAEIVSAVTR 451
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  430 TAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKVDTTSS-ARSGAQKM 508
Cdd:PRK15041 452 VTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQQqQRETSAVV 531
                        330
                 ....*....|...
gi 86359111  509 PANGSAKVVKAAA 521
Cdd:PRK15041 532 KTVTPATPRKMAV 544
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
114-526 1.16e-47

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 174.81  E-value: 1.16e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  114 IAEFSKSFNAADDQIRDYVKTGNAEGANTisiTTARAAANGIDSALAEI-LALEKQRMKAADAGADaQYETTRTTMIAVA 192
Cdd:PRK15048 123 IDEKYKNYYTALTELIDYLDYGNTGAYFA---QPTQGMQNAMGEAFAQYaLSSEKLYRDIVTDNAD-DYRFAQWQLAVIA 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  193 AVALLIAAMTAFWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSG 272
Cdd:PRK15048 199 LVVVLILLVAWYGIRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAG 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  273 SQELSASSEQVSQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAM-------RT 345
Cdd:PRK15048 279 TREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMheiadssKK 358
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  346 IALKISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTVKA-------AADAGE 418
Cdd:PRK15048 359 IADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRvdtgsvlVESAGE 438
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  419 MLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKVdtt 498
Cdd:PRK15048 439 TMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRL--- 515
                        410       420
                 ....*....|....*....|....*...
gi 86359111  499 sSARSGAQKMPANGSAKVVKAAARKPAL 526
Cdd:PRK15048 516 -AASPLTNKPQTPSRPASEQPPAQPRLR 542
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
204-510 7.27e-45

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 166.40  E-value: 7.27e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  204 FWIASTISKGLSRANTVVREVSEGDLTKMADITSHDEIGELLGNVNIMIERLRGVVADAISAAENVSSGSQELSASSEQV 283
Cdd:PRK09793 208 WWTRKMIVQPLAIIGSHFDSIAAGNLARPIAVYGRNEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDL 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  284 SQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALK-------ISIVQEI 356
Cdd:PRK09793 288 SSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSsqkigdiISVIDGI 367
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  357 ARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSMSSDTV-------KAAADAGEMLGRLVPDIRK 429
Cdd:PRK09793 368 AFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVnrvqqgsKLVNNAAATMTDIVSSVTR 447
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  430 TAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKVDTTSSARSGAQKMP 509
Cdd:PRK09793 448 VNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVFTLEEHEVARHESAQLQ 527

                 .
gi 86359111  510 A 510
Cdd:PRK09793 528 I 528
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
261-494 1.69e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.29  E-value: 1.69e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    261 DAISAAENVSSGSQELSASSEQVSQGATEQAASAEEASASMEQMAANIKQNADNAAQTEKIARQSARDAEASGEAVTRAV 340
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    341 DAMRTIALK-------ISIVQEIARQTDLLALNAAVEAARAGEHGKGFAVVASEVRKLAERSQSAAAEISSM-------- 405
Cdd:smart00283  81 SAVEELEESsdeigeiVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLikeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    406 -------------SSDTVKAAADAGEMLGRLVPDIRKTAELVSEISAACREQDIGAAQINEAIQQLDKVTQQNAGASEQM 472
Cdd:smart00283 161 neavaameessseVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 86359111    473 SATSEELASQAEELQTSIAFFK 494
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
310-495 2.50e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 120.63  E-value: 2.50e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111   310 QNADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALKIS----IVQEIARQTDLLALNAAVEAARAGEHGKGFAVVA 385
Cdd:pfam00015   2 QASDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISdiisVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVA 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111   386 SEVRKLAERSQSAAAEISSMSSDTVK---------------------AAADAGEMLGRLVPDIRKTAELVSEISAACREQ 444
Cdd:pfam00015  82 DEVRKLAERSAQAAKEIEALIEEIVKqtndstasiqqtrtevevgstIVESTGEALKEIVDAVAEIADIVQEIAAASDEQ 161
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 86359111   445 DIGAAQINEAIQQLDKVTQQNAGASEQMSATSEELASQAEELQTSIAFFKV 495
Cdd:pfam00015 162 SAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFRI 212
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
312-494 1.98e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 39.79  E-value: 1.98e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    312 ADNAAQTEKIARQSARDAEASGEAVTRAVDAMRTIALKISIVQEIArqTDLLALNAAVEA-ARAGEHGKGFAVVASEVRK 390
Cdd:TIGR02680  795 AAEAERQAESAERELARAARKAAAAAAAWKQARRELERDAADLDLP--TDPDALEAVGLAlKRFGDHLHTLEVAVRELRH 872
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111    391 LAERSQSAAAEISSMSSDTVKAAADAGEMLGRL------VPDIRKT-----AELVSEISAACREQDIGAAQINEAIQQLD 459
Cdd:TIGR02680  873 AATRAAEQRARAARAESDAREAAEDAAEARAEAeeaslrLRTLEESvgamvDEIRARLAETRAALASGGRELPRLAEALA 952
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 86359111    460 KVTQQNAGASEQMSATSEELASQAEELQTSIAFFK 494
Cdd:TIGR02680  953 TAEEARGRAEEKRAEADATLDERAEARDHAIGQLR 987
PRK05035 PRK05035
electron transport complex protein RnfC; Provisional
315-531 9.59e-03

electron transport complex protein RnfC; Provisional


Pssm-ID: 235334 [Multi-domain]  Cd Length: 695  Bit Score: 37.23  E-value: 9.59e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  315 AAQTEKIARQSARDAEASGEAVTRAVDamRTIALKISIVQEIARQTDLLALNAAVEAARagehgkgfavvasEVRKLAER 394
Cdd:PRK05035 467 AAREARHKKAAEARAAKDKDAVAAALA--RVKAKKAAATQPIVIKAGARPDNSAVIAAR-------------EARKAQAR 531
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86359111  395 SQSAAAEISSmSSDTVKAAADAGEMLGRLvpdirKTAELVSEISAACREQDIGAAQINEAIQQLD-KVTQQNAGASEQMS 473
Cdd:PRK05035 532 ARQAEKQAAA-AADPKKAAVAAAIARAKA-----KKAAQQAANAEAEEEVDPKKAAVAAAIARAKaKKAAQQAASAEPEE 605
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 86359111  474 ATSEELASQAeELQTSIAFFKVDTTSSARSGAQKMP-----ANGSAKVVKAAARKPALQVQSQ 531
Cdd:PRK05035 606 QVAEVDPKKA-AVAAAIARAKAKKAEQQANAEPEEPvdprkAAVAAAIARAKARKAAQQQANA 667
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH