NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85859161|ref|YP_461363|]
View 

adenylate cyclase [Syntrophus aciditrophicus SB]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Adenyl_cycl_N super family cl14996
Adenylate cyclase NT domain;
39-231 1.11e-29

Adenylate cyclase NT domain;


The actual alignment was detected with superfamily member pfam12633:

Pssm-ID: 257178  Cd Length: 204  Bit Score: 116.64  E-value: 1.11e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161    39 NRFR-KRLFSELAPkDSEIILYLLPWMLSVNDVSIPGYVD-HIKQNFRVFNI-ETEKDILKRERLFKKTFHIRNDLTVLK 115
Cdd:pfam12633  16 NRLRiERALALMSP-QFQHVFQLIPLLLHYNHPNLPGYVDgDAPSGIAQFQLsDYQQQFLSTLDLDAELSVDEPLKTSTH 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   116 PaekslPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLYDEEAfDLLTLKIDRIKDWMDSrLKMPVCFFLCDVEDIRACR 195
Cdd:pfam12633  95 P-----PILGLYSMGSTSSIGQTSSSDLDIWVCHSDQLSPEER-ELLEQKCALITQWAEQ-FGVEVNFFLIDENRFRHNN 167
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 85859161   196 FGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWW 231
Cdd:pfam12633 168 YADaMTGENCGSAQHMLLLDEFYRSAIRLAGKRLLWL 204
Adenylate_cycl super family cl14947
Adenylate cyclase, class-I;
258-575 1.33e-14

Adenylate cyclase, class-I;


The actual alignment was detected with superfamily member pfam01295:

Pssm-ID: 250514  Cd Length: 599  Bit Score: 75.78  E-value: 1.33e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   258 DLIDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLILDQPRKPHSFvDPGAFTL 336
Cdd:pfam01295   1 EWLDFGGLSRISAEEYFGASLWQLYKGIDSPYKAvLKILLLEAYSSEYPNTRLISKEFKQRLLEGDTVSYHF-DPYLLML 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   337 IAVLDF--YQNmDPQTLQFILKCFYLRYKVKLfSRtmtvKEETALELFRRYGLDR---------ETIYELNRFSSWTYSS 405
Cdd:pfam01295  80 EKVTRYltKIN-DLKRLDLVRRCFYLKATEGL-SR----EQSNQAVNWRRQKLSElvnqwnwseELLQHLDNRENWKIKQ 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   406 QIRFGEFIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSkPL--ETLKMPSLTL------ 475
Cdd:pfam01295 154 VKEAHNELLDALMQSYRNLIQFARknNISESISPQDIGILTRKLYTAFEELPGKVTLIN-PQisPDLSEPDLTFievpeg 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   476 RFCENRWQVFPDNDDGAMIVEKRDLVY--CLAYL-AWNdlYFPG------QLRmLPNPTSAAMQEIINLLQKIREVFGVY 546
Cdd:pfam01295 233 RANKAGWYLYNQSPDPRYFSGQRYLEYnkYLSKLvAWA--YFNGlltdktQLH-IVSQNSDLDDKLRQFVTDLRLSFPVR 309
                         330       340
                  ....*....|....*....|....*....
gi 85859161   547 DVSSIDfQNFLQPEHTEKLLIIINFAAPP 575
Cdd:pfam01295 310 APKPTN-QALTHPCEIRSLAIFLNLEKDP 337
 
Name Accession Description Interval E-value
Adenyl_cycl_N pfam12633
Adenylate cyclase NT domain;
39-231 1.11e-29

Adenylate cyclase NT domain;


Pssm-ID: 257178  Cd Length: 204  Bit Score: 116.64  E-value: 1.11e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161    39 NRFR-KRLFSELAPkDSEIILYLLPWMLSVNDVSIPGYVD-HIKQNFRVFNI-ETEKDILKRERLFKKTFHIRNDLTVLK 115
Cdd:pfam12633  16 NRLRiERALALMSP-QFQHVFQLIPLLLHYNHPNLPGYVDgDAPSGIAQFQLsDYQQQFLSTLDLDAELSVDEPLKTSTH 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   116 PaekslPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLYDEEAfDLLTLKIDRIKDWMDSrLKMPVCFFLCDVEDIRACR 195
Cdd:pfam12633  95 P-----PILGLYSMGSTSSIGQTSSSDLDIWVCHSDQLSPEER-ELLEQKCALITQWAEQ-FGVEVNFFLIDENRFRHNN 167
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 85859161   196 FGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWW 231
Cdd:pfam12633 168 YADaMTGENCGSAQHMLLLDEFYRSAIRLAGKRLLWL 204
Adenylate_cycl pfam01295
Adenylate cyclase, class-I;
258-575 1.33e-14

Adenylate cyclase, class-I;


Pssm-ID: 250514  Cd Length: 599  Bit Score: 75.78  E-value: 1.33e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   258 DLIDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLILDQPRKPHSFvDPGAFTL 336
Cdd:pfam01295   1 EWLDFGGLSRISAEEYFGASLWQLYKGIDSPYKAvLKILLLEAYSSEYPNTRLISKEFKQRLLEGDTVSYHF-DPYLLML 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   337 IAVLDF--YQNmDPQTLQFILKCFYLRYKVKLfSRtmtvKEETALELFRRYGLDR---------ETIYELNRFSSWTYSS 405
Cdd:pfam01295  80 EKVTRYltKIN-DLKRLDLVRRCFYLKATEGL-SR----EQSNQAVNWRRQKLSElvnqwnwseELLQHLDNRENWKIKQ 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   406 QIRFGEFIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSkPL--ETLKMPSLTL------ 475
Cdd:pfam01295 154 VKEAHNELLDALMQSYRNLIQFARknNISESISPQDIGILTRKLYTAFEELPGKVTLIN-PQisPDLSEPDLTFievpeg 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   476 RFCENRWQVFPDNDDGAMIVEKRDLVY--CLAYL-AWNdlYFPG------QLRmLPNPTSAAMQEIINLLQKIREVFGVY 546
Cdd:pfam01295 233 RANKAGWYLYNQSPDPRYFSGQRYLEYnkYLSKLvAWA--YFNGlltdktQLH-IVSQNSDLDDKLRQFVTDLRLSFPVR 309
                         330       340
                  ....*....|....*....|....*....
gi 85859161   547 DVSSIDfQNFLQPEHTEKLLIIINFAAPP 575
Cdd:pfam01295 310 APKPTN-QALTHPCEIRSLAIFLNLEKDP 337
cyaA PRK09450
adenylate cyclase; Provisional
5-620 2.31e-180

adenylate cyclase; Provisional


Pssm-ID: 236522 [Multi-domain]  Cd Length: 830  Bit Score: 536.42  E-value: 2.31e-180
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161    5 RKTAIDLCRSREDAGIRMALSRILIQNKSIFleynrfrkrlfselapkdsEIILYLLPWMLSVNDVSIPGYVD-HIKQNF 83
Cdd:PRK09450   1 MRKYLETLKQRLDALNQLRLARALAALSPAF-------------------QQVLSLLPLLLHVNHPLLPGYVSgNTPAGI 61
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   84 RVFN-IETEKDILKRERLFKkTFHIRndltvlKPAEKSLPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLyDEEAFDLL 162
Cdd:PRK09450  62 CNFTpDETQLAYLQRLELSF-GYSVQ------DPPKGELPITGLYTMGSTGSIGQSESSDLDIWVCHRPWL-DAEERQLL 133
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  163 TLKIDRIKDWMDSrLKMPVCFFLCDVEDIRACRFGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWWVAWDRRQTlC 241
Cdd:PRK09450 134 QRKCSLLEQWAAS-LGVEVNFFLMDEERFRHNESGSaLGGEDCGSTQHILLLDEFYRTAIRLAGKRPLWWLVPVEEEE-H 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  242 YDDAVREWQSAPSVY-YDLIDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLIL 319
Cdd:PRK09450 212 YDDYVMTLYSKGFLNpNEWLDLGGLSSLPAEEYFGASLWQLYKGIDSPYKSvLKLLLLEAYSSEYPNTQLLSLDFKQRLL 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  320 DQPRKPHSFvDPGAFTLIAVLDFYQNM-DPQTLQFILKCFYLRYKVKLFS--RTMTVKEETALELFRRYGLDRETIYELN 396
Cdd:PRK09450 292 AGEIDSDGL-DPYCLMLERVTRYLTAInDPTRLELVRRCFYLKVGEKLSRerACVGWRRELLSQLVSEWGWDEERLALLD 370
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  397 RFSSWTYSSQIRFGEFIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSKPL-ETLKMPSL 473
Cdd:PRK09450 371 NRANWKIGQVREFHNELVDALMQSYRNLIRFARrnNLSSSISPQDIGILTRKLYAAFERLPGKVTLLNPQIsPDLSEPDL 450
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  474 TLRFCENR------WQVFPDNDDGAMIVEK------RDLVYCLAYLAWNDLYFPG-QLRMLPNPTSAAMQEIINLLQKIR 540
Cdd:PRK09450 451 TFIEVPPGranrsgWYLYNQAPDPDSIIGHqpleynRYLNKLVAWAYFNGLLTSStRLHLKGNGSDLDLAKLQELVADLR 530
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  541 EVFGVYdVSSIDFQNFLQPEHTEKLLIIINFAAPPHADVIH------------------------TLSVIRLNNWGELFV 596
Cdd:PRK09450 531 QHFPLR-LPAPTPQALLQPCEIRHLLIIVNLEVDPTAHLRGqvvhfdfrnldvfsfggeqenlvgSVDLIYRNSWNEVRT 609
                        650       660
                 ....*....|....*....|....
gi 85859161  597 NRFTLQERFISFLENIAESSYNTV 620
Cdd:PRK09450 610 LHFEGEQALLDALKTILGKMHQDA 633
CyaA COG3072
Adenylate cyclase [Nucleotide transport and metabolism]
28-575 1.31e-54

Adenylate cyclase [Nucleotide transport and metabolism]


Pssm-ID: 225614 [Multi-domain]  Cd Length: 853  Bit Score: 199.62  E-value: 1.31e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  28 LIQNKSIFLEYNRFR-KRLFSELAPKdSEIILYLLPWMLSVNDVSIPGYVD-HIKQNFRVFNI-ETEKDILKRERLFKKT 104
Cdd:COG3072   5 LETLKQRLDALNQLRvERALAAMGPA-FQRVLSLLPLLLHINHPLLPGYLDgNVPAGICLFTAdDYQKQYLAEAQELYRG 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 105 FhirndltVLKP---AEKSLPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLyDEEAFDLLTLKIDRIKDWMDSrLKMPV 181
Cdd:COG3072  84 M-------SLLPsrqPKGELPILGVYTMGSTSSIGQSCSSDLDIWVCHQDWL-STEERQLLQRKCSLLEDWAAS-QGVEV 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 182 CFFLCDVEDIRACRFGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWWVAWDRRQTlCYDDAVREWQSAPSVYY-DL 259
Cdd:COG3072 155 NFFLIDENRFRQHNESGsLGGEDCGSTQHILLLDEFYRSAVRLAGKRLLWLMVPPEEEE-HYDDYVMTLYAQGVITPnEW 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 260 IDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLILDQPRKPHSFvDPgaftLIA 338
Cdd:COG3072 234 LDLGGLSQLSAEEYFGASLWQLYKSIDSPYKSvLKTLLLEAYSWEYPNTRLLARDFKERLHAGELVSFGL-DP----YCM 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 339 VLD-----FYQNMDPQTLQFILKCFYLRYKVKLFSR--TMTVKEETALELFRRYGLDRETIYELNRFSSWTYSSQIRFGE 411
Cdd:COG3072 309 MLErvtryLTAIEDFTRLDLVRRCFYLKVCEKLSREqaCNGWRREVLEQLVSEWGWSAARLAELDNRANWKIKQVKEAHN 388
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 412 FIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSKPLE-TLKMPSLTL-RFCENR-----W 482
Cdd:COG3072 389 ELLDALMLSYRNLIRFARrnNLSSSISPQDIGVLTRKLYAAFEALPGKVTLLNPQISpDLSEPNLTFiEVPAGRankdgW 468
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 483 QVFPDNDDGAMIVEKRDLVYCLA---YLAWndLYFPG------QLRMLPNPtSAAMQEIINLLQKIREVFGVyDVSSIDF 553
Cdd:COG3072 469 YLYNQAPNAHSIISHQPLEYNEYlnkLVAW--AYFNGlltsrtRLHIKSNG-NVDLPKLQEMVTDLRQHFPL-RLAAPTP 544
                       570       580
                ....*....|....*....|..
gi 85859161 554 QNFLQPEHTEKLLIIINFAAPP 575
Cdd:COG3072 545 KDLLSPCEIRSLAIIVNLEVDP 566
 
Name Accession Description Interval E-value
Adenyl_cycl_N pfam12633
Adenylate cyclase NT domain;
39-231 1.11e-29

Adenylate cyclase NT domain;


Pssm-ID: 257178  Cd Length: 204  Bit Score: 116.64  E-value: 1.11e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161    39 NRFR-KRLFSELAPkDSEIILYLLPWMLSVNDVSIPGYVD-HIKQNFRVFNI-ETEKDILKRERLFKKTFHIRNDLTVLK 115
Cdd:pfam12633  16 NRLRiERALALMSP-QFQHVFQLIPLLLHYNHPNLPGYVDgDAPSGIAQFQLsDYQQQFLSTLDLDAELSVDEPLKTSTH 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   116 PaekslPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLYDEEAfDLLTLKIDRIKDWMDSrLKMPVCFFLCDVEDIRACR 195
Cdd:pfam12633  95 P-----PILGLYSMGSTSSIGQTSSSDLDIWVCHSDQLSPEER-ELLEQKCALITQWAEQ-FGVEVNFFLIDENRFRHNN 167
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 85859161   196 FGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWW 231
Cdd:pfam12633 168 YADaMTGENCGSAQHMLLLDEFYRSAIRLAGKRLLWL 204
Adenylate_cycl pfam01295
Adenylate cyclase, class-I;
258-575 1.33e-14

Adenylate cyclase, class-I;


Pssm-ID: 250514  Cd Length: 599  Bit Score: 75.78  E-value: 1.33e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   258 DLIDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLILDQPRKPHSFvDPGAFTL 336
Cdd:pfam01295   1 EWLDFGGLSRISAEEYFGASLWQLYKGIDSPYKAvLKILLLEAYSSEYPNTRLISKEFKQRLLEGDTVSYHF-DPYLLML 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   337 IAVLDF--YQNmDPQTLQFILKCFYLRYKVKLfSRtmtvKEETALELFRRYGLDR---------ETIYELNRFSSWTYSS 405
Cdd:pfam01295  80 EKVTRYltKIN-DLKRLDLVRRCFYLKATEGL-SR----EQSNQAVNWRRQKLSElvnqwnwseELLQHLDNRENWKIKQ 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   406 QIRFGEFIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSkPL--ETLKMPSLTL------ 475
Cdd:pfam01295 154 VKEAHNELLDALMQSYRNLIQFARknNISESISPQDIGILTRKLYTAFEELPGKVTLIN-PQisPDLSEPDLTFievpeg 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   476 RFCENRWQVFPDNDDGAMIVEKRDLVY--CLAYL-AWNdlYFPG------QLRmLPNPTSAAMQEIINLLQKIREVFGVY 546
Cdd:pfam01295 233 RANKAGWYLYNQSPDPRYFSGQRYLEYnkYLSKLvAWA--YFNGlltdktQLH-IVSQNSDLDDKLRQFVTDLRLSFPVR 309
                         330       340
                  ....*....|....*....|....*....
gi 85859161   547 DVSSIDfQNFLQPEHTEKLLIIINFAAPP 575
Cdd:pfam01295 310 APKPTN-QALTHPCEIRSLAIFLNLEKDP 337
cyaA PRK09450
adenylate cyclase; Provisional
5-620 2.31e-180

adenylate cyclase; Provisional


Pssm-ID: 236522 [Multi-domain]  Cd Length: 830  Bit Score: 536.42  E-value: 2.31e-180
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161    5 RKTAIDLCRSREDAGIRMALSRILIQNKSIFleynrfrkrlfselapkdsEIILYLLPWMLSVNDVSIPGYVD-HIKQNF 83
Cdd:PRK09450   1 MRKYLETLKQRLDALNQLRLARALAALSPAF-------------------QQVLSLLPLLLHVNHPLLPGYVSgNTPAGI 61
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161   84 RVFN-IETEKDILKRERLFKkTFHIRndltvlKPAEKSLPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLyDEEAFDLL 162
Cdd:PRK09450  62 CNFTpDETQLAYLQRLELSF-GYSVQ------DPPKGELPITGLYTMGSTGSIGQSESSDLDIWVCHRPWL-DAEERQLL 133
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  163 TLKIDRIKDWMDSrLKMPVCFFLCDVEDIRACRFGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWWVAWDRRQTlC 241
Cdd:PRK09450 134 QRKCSLLEQWAAS-LGVEVNFFLMDEERFRHNESGSaLGGEDCGSTQHILLLDEFYRTAIRLAGKRPLWWLVPVEEEE-H 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  242 YDDAVREWQSAPSVY-YDLIDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLIL 319
Cdd:PRK09450 212 YDDYVMTLYSKGFLNpNEWLDLGGLSSLPAEEYFGASLWQLYKGIDSPYKSvLKLLLLEAYSSEYPNTQLLSLDFKQRLL 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  320 DQPRKPHSFvDPGAFTLIAVLDFYQNM-DPQTLQFILKCFYLRYKVKLFS--RTMTVKEETALELFRRYGLDRETIYELN 396
Cdd:PRK09450 292 AGEIDSDGL-DPYCLMLERVTRYLTAInDPTRLELVRRCFYLKVGEKLSRerACVGWRRELLSQLVSEWGWDEERLALLD 370
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  397 RFSSWTYSSQIRFGEFIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSKPL-ETLKMPSL 473
Cdd:PRK09450 371 NRANWKIGQVREFHNELVDALMQSYRNLIRFARrnNLSSSISPQDIGILTRKLYAAFERLPGKVTLLNPQIsPDLSEPDL 450
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  474 TLRFCENR------WQVFPDNDDGAMIVEK------RDLVYCLAYLAWNDLYFPG-QLRMLPNPTSAAMQEIINLLQKIR 540
Cdd:PRK09450 451 TFIEVPPGranrsgWYLYNQAPDPDSIIGHqpleynRYLNKLVAWAYFNGLLTSStRLHLKGNGSDLDLAKLQELVADLR 530
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  541 EVFGVYdVSSIDFQNFLQPEHTEKLLIIINFAAPPHADVIH------------------------TLSVIRLNNWGELFV 596
Cdd:PRK09450 531 QHFPLR-LPAPTPQALLQPCEIRHLLIIVNLEVDPTAHLRGqvvhfdfrnldvfsfggeqenlvgSVDLIYRNSWNEVRT 609
                        650       660
                 ....*....|....*....|....
gi 85859161  597 NRFTLQERFISFLENIAESSYNTV 620
Cdd:PRK09450 610 LHFEGEQALLDALKTILGKMHQDA 633
CyaA COG3072
Adenylate cyclase [Nucleotide transport and metabolism]
28-575 1.31e-54

Adenylate cyclase [Nucleotide transport and metabolism]


Pssm-ID: 225614 [Multi-domain]  Cd Length: 853  Bit Score: 199.62  E-value: 1.31e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161  28 LIQNKSIFLEYNRFR-KRLFSELAPKdSEIILYLLPWMLSVNDVSIPGYVD-HIKQNFRVFNI-ETEKDILKRERLFKKT 104
Cdd:COG3072   5 LETLKQRLDALNQLRvERALAAMGPA-FQRVLSLLPLLLHINHPLLPGYLDgNVPAGICLFTAdDYQKQYLAEAQELYRG 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 105 FhirndltVLKP---AEKSLPVEGIYTIGSVGTISQTSSSDCDLWICIDKTLyDEEAFDLLTLKIDRIKDWMDSrLKMPV 181
Cdd:COG3072  84 M-------SLLPsrqPKGELPILGVYTMGSTSSIGQSCSSDLDIWVCHQDWL-STEERQLLQRKCSLLEDWAAS-QGVEV 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 182 CFFLCDVEDIRACRFGG-VDCESCGSTQKKVLKEEFYRTAILTAGKIPLWWVAWDRRQTlCYDDAVREWQSAPSVYY-DL 259
Cdd:COG3072 155 NFFLIDENRFRQHNESGsLGGEDCGSTQHILLLDEFYRSAVRLAGKRLLWLMVPPEEEE-HYDDYVMTLYAQGVITPnEW 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 260 IDLGNLDFIDKRESFGAALWQFNKSLTHPLKS-ILKMLLLKMFLESPKEELLCHRFRRLILDQPRKPHSFvDPgaftLIA 338
Cdd:COG3072 234 LDLGGLSQLSAEEYFGASLWQLYKSIDSPYKSvLKTLLLEAYSWEYPNTRLLARDFKERLHAGELVSFGL-DP----YCM 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 339 VLD-----FYQNMDPQTLQFILKCFYLRYKVKLFSR--TMTVKEETALELFRRYGLDRETIYELNRFSSWTYSSQIRFGE 411
Cdd:COG3072 309 MLErvtryLTAIEDFTRLDLVRRCFYLKVCEKLSREqaCNGWRREVLEQLVSEWGWSAARLAELDNRANWKIKQVKEAHN 388
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 412 FIVLLLVDIYKDIAHIAR--DVTGDVAAQDLTILGQKLSASLKKKPHKIPVLSKPLE-TLKMPSLTL-RFCENR-----W 482
Cdd:COG3072 389 ELLDALMLSYRNLIRFARrnNLSSSISPQDIGVLTRKLYAAFEALPGKVTLLNPQISpDLSEPNLTFiEVPAGRankdgW 468
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859161 483 QVFPDNDDGAMIVEKRDLVYCLA---YLAWndLYFPG------QLRMLPNPtSAAMQEIINLLQKIREVFGVyDVSSIDF 553
Cdd:COG3072 469 YLYNQAPNAHSIISHQPLEYNEYlnkLVAW--AYFNGlltsrtRLHIKSNG-NVDLPKLQEMVTDLRQHFPL-RLAAPTP 544
                       570       580
                ....*....|....*....|..
gi 85859161 554 QNFLQPEHTEKLLIIINFAAPP 575
Cdd:COG3072 545 KDLLSPCEIRSLAIIVNLEVDP 566
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH