NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85859025|ref|YP_461227|]
View 

methyl-accepting chemotaxis protein [Syntrophus aciditrophicus SB]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl21547
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
222-428 6.86e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 120.80  E-value: 6.86e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 222 EEVATASGLVSSSSQNVADgtaaqassleetsssleemssMTRNNSDHAKQARAMMGKTQRIVEKVNSHMDEMTQAINEI 301
Cdd:cd11386   1 EELSASIEEVAASADQVAE---------------------TSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEEL 59
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 302 NKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIANTMQAVSNGNEL 381
Cdd:cd11386  60 EESSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEA 139
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 85859025 382 TKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMD 428
Cdd:cd11386 140 MEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQS 186
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
222-428 6.86e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 120.80  E-value: 6.86e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 222 EEVATASGLVSSSSQNVADgtaaqassleetsssleemssMTRNNSDHAKQARAMMGKTQRIVEKVNSHMDEMTQAINEI 301
Cdd:cd11386   1 EELSASIEEVAASADQVAE---------------------TSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEEL 59
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 302 NKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIANTMQAVSNGNEL 381
Cdd:cd11386  60 EESSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEA 139
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 85859025 382 TKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMD 428
Cdd:cd11386 140 MEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQS 186
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
219-429 1.81e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 127.02  E-value: 1.81e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025    219 SFVEEVATASGLVSSSSQNVADGTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNSHMDEMTQAI 298
Cdd:smart00283   4 EAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025    299 NEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIAN-------- 370
Cdd:smart00283  84 EELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeetnea 163
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 85859025    371 ------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:smart00283 164 vaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQ 228
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
267-429 5.32e-32

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 121.40  E-value: 5.32e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025   267 SDHAKQARammGKTQRIVEKVNSHMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVV 346
Cdd:pfam00015   4 SDLAQLAS---EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025   347 AEEVRNLATRSADAAKNTSKLIAN--------------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEE 412
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEivkqtndstasiqqTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170
                  ....*....|....*..
gi 85859025   413 QAQGIAQINHAVAAMDK 429
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQ 177
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
210-429 2.00e-30

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 122.10  E-value: 2.00e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  210 VNRIAQELHSFVEEVATASGLVSSSsqnvadgTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNS 289
Cdd:PRK09793 266 VRKGSQEMHIGIAEIVAGNNDLSSR-------TEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGV 338
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  290 HMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIA 369
Cdd:PRK09793 339 QVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE 418
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  370 NTMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:PRK09793 419 ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQ 478
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
213-462 1.12e-27

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 112.78  E-value: 1.12e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 213 IAQELHSFVEEVATASGLVSSSSQNVADGTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNSHMD 292
Cdd:COG0840 132 IIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVR 211
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 293 EMTQAINEIN-----------KSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAA 361
Cdd:COG0840 212 QAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSA 291
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 362 KNTSKLIAN--------------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAM 427
Cdd:COG0840 292 KEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEEL 371
                       250       260       270
                ....*....|....*....|....*....|....*
gi 85859025 428 DKATQEAAAHAEESADASKILNQKAIEIQHHINEL 462
Cdd:COG0840 372 DDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
222-428 6.86e-32

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 120.80  E-value: 6.86e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 222 EEVATASGLVSSSSQNVADgtaaqassleetsssleemssMTRNNSDHAKQARAMMGKTQRIVEKVNSHMDEMTQAINEI 301
Cdd:cd11386   1 EELSASIEEVAASADQVAE---------------------TSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEEL 59
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 302 NKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIANTMQAVSNGNEL 381
Cdd:cd11386  60 EESSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEA 139
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 85859025 382 TKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMD 428
Cdd:cd11386 140 MEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQEQS 186
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
219-429 1.81e-33

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 127.02  E-value: 1.81e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025    219 SFVEEVATASGLVSSSSQNVADGTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNSHMDEMTQAI 298
Cdd:smart00283   4 EAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025    299 NEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIAN-------- 370
Cdd:smart00283  84 EELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEiqeetnea 163
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 85859025    371 ------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:smart00283 164 vaameeSSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQ 228
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
267-429 5.32e-32

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 121.40  E-value: 5.32e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025   267 SDHAKQARammGKTQRIVEKVNSHMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVV 346
Cdd:pfam00015   4 SDLAQLAS---EEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025   347 AEEVRNLATRSADAAKNTSKLIAN--------------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEE 412
Cdd:pfam00015  81 ADEVRKLAERSAQAAKEIEALIEEivkqtndstasiqqTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDE 160
                         170
                  ....*....|....*..
gi 85859025   413 QAQGIAQINHAVAAMDK 429
Cdd:pfam00015 161 QSAGIDQVNQAVARIDQ 177
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
210-429 2.00e-30

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 122.10  E-value: 2.00e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  210 VNRIAQELHSFVEEVATASGLVSSSsqnvadgTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNS 289
Cdd:PRK09793 266 VRKGSQEMHIGIAEIVAGNNDLSSR-------TEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGV 338
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  290 HMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLIA 369
Cdd:PRK09793 339 QVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIE 418
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  370 NTMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:PRK09793 419 ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQ 478
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
206-429 2.31e-29

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 119.34  E-value: 2.31e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  206 VTRPVNRIAQELHSFVEEVATASGLVSSSSQNVADG-------TAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMG 278
Cdd:PRK15048 250 LAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGntdlssrTEQQASALEETAASMEQLTATVKQNADNARQASQLAQ 329
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  279 KTQRIVEKVNSHMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSA 358
Cdd:PRK15048 330 SASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSA 409
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85859025  359 DAAKNTSKLIANTMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:PRK15048 410 QAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDR 480
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
216-429 9.99e-28

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 114.67  E-value: 9.99e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  216 ELHSFVEEVATASGLVSSSSQNVADG-------TAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVN 288
Cdd:PRK15041 262 ELMRTVGDVRNGANAIYSGASEIATGnndlssrTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGG 341
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025  289 SHMDEMTQAINEINKSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAAKNTSKLI 368
Cdd:PRK15041 342 KVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLI 421
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85859025  369 ANTMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAMDK 429
Cdd:PRK15041 422 EDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDR 482
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
213-462 1.12e-27

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 112.78  E-value: 1.12e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 213 IAQELHSFVEEVATASGLVSSSSQNVADGTAAQASSLEETSSSLEEMSSMTRNNSDHAKQARAMMGKTQRIVEKVNSHMD 292
Cdd:COG0840 132 IIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVR 211
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 293 EMTQAINEIN-----------KSSEETGKIIKTIDEIAFQTNLLALNAAVEAARAGEAGAGFAVVAEEVRNLATRSADAA 361
Cdd:COG0840 212 QAVEQMQEIAeelaevvkklsESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSA 291
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85859025 362 KNTSKLIAN--------------TMQAVSNGNELTKATQEAFQDNVEISVQIAQIVDEITTASEEQAQGIAQINHAVAAM 427
Cdd:COG0840 292 KEIGLLIEEiqneaadavehmeeSASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEEL 371
                       250       260       270
                ....*....|....*....|....*....|....*
gi 85859025 428 DKATQEAAAHAEESADASKILNQKAIEIQHHINEL 462
Cdd:COG0840 372 DDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH