NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85108961|ref|XP_962679|]
View 

DNA replication licensing factor mcm3 [Neurospora crassa OR74A]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
346-491 1.02e-03

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


:

Pssm-ID: 99707  Cd Length: 151  Bit Score: 39.44  E-value: 1.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 346 NILMVGDPSTAKSQLLRFVLNTAPLA----IATTGrgsSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMS 421
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPgapfLYLNA---SDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLS 97
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 422 DIDRVAIHEVMEQQTVTIAKagihtslNARCSVIAAANPIFgqydthkdphkNIALPDSLLSRFDLLFVV 491
Cdd:cd00009  98 RGAQNALLRVLETLNDLRID-------RENVRVIGATNRPL-----------LGDLDRALYDRLDIRIVI 149
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
14-132 1.43e-15

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


:

Pssm-ID: 258689  Cd Length: 117  Bit Score: 74.56  E-value: 1.43e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    14 RVRQAQEFLD-PHDQHQRSYRPDIVLMLQKNQRRLVVNIDHVRDHSSEVAEGLLTDPFNWTLAFNHALKTIVSTVPQARP 92
Cdd:pfam14551   1 IKRRFREFLReFKGGGEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFPP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 85108961    93 -DQIDPDVlyycaWAGSFGL-HTCNPRTLSSQHLNNMVSIEG 132
Cdd:pfam14551  81 eLKRRKEI-----QVRFYNLpKVVSIRDLRSSHIGKLVSVEG 117
MCM smart00350
minichromosome maintenance proteins;
112-667 0e+00

minichromosome maintenance proteins;


:

Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 659.34  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    112 HTCNPRTLSSQHLNNMVSIEGIVTRTSLIRPKVVKS---VHYSEAKKTFHYREYRDQTMTngivtnSVYPREDEEGNPLE 188
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPT------VCPPRECQSPTPFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    189 TEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDRVKPGDRIQLVGIFRTL--GNRNTNHNS-ALFKTVILA 265
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpyGFKLNTVKGlPVFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    266 NNIVLLSSKS---GGGVATATITDTDIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEKNLENGTHLR 342
Cdd:smart00350 155 NHVRKLDYKRsfeDSSFSVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIR 234
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    343 GDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSD 422
Cdd:smart00350 235 GDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDD 314
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    423 IDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQ 502
Cdd:smart00350 315 SDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRE 394
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    503 VSEHVLRMHRYRQPgteegapvrenagqalnvalngqSESQKPTEMwekydamlhagikvpsgrgsankkpeiLSIPFMK 582
Cdd:smart00350 395 LAKHVVDLHRYSHP-----------------------EEDEAFEPP---------------------------LSQEKLR 424
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    583 KYIQYAKTRIKPVLTQEASDRIADIYVGLRNDDMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEERDAAAAESIL 662
Cdd:smart00350 425 KYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLL 504

                   ....*
gi 85108961    663 RFALF 667
Cdd:smart00350 505 RESII 509
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
346-491 1.02e-03

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 39.44  E-value: 1.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 346 NILMVGDPSTAKSQLLRFVLNTAPLA----IATTGrgsSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMS 421
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPgapfLYLNA---SDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLS 97
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 422 DIDRVAIHEVMEQQTVTIAKagihtslNARCSVIAAANPIFgqydthkdphkNIALPDSLLSRFDLLFVV 491
Cdd:cd00009  98 RGAQNALLRVLETLNDLRID-------RENVRVIGATNRPL-----------LGDLDRALYDRLDIRIVI 149
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
14-132 1.43e-15

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


Pssm-ID: 258689  Cd Length: 117  Bit Score: 74.56  E-value: 1.43e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    14 RVRQAQEFLD-PHDQHQRSYRPDIVLMLQKNQRRLVVNIDHVRDHSSEVAEGLLTDPFNWTLAFNHALKTIVSTVPQARP 92
Cdd:pfam14551   1 IKRRFREFLReFKGGGEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFPP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 85108961    93 -DQIDPDVlyycaWAGSFGL-HTCNPRTLSSQHLNNMVSIEG 132
Cdd:pfam14551  81 eLKRRKEI-----QVRFYNLpKVVSIRDLRSSHIGKLVSVEG 117
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
346-485 1.12e-03

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 254388  Cd Length: 135  Bit Score: 38.82  E-value: 1.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   346 NILMVGDPSTAKSQLLRFvlntapLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADR---------GVVCIDE 416
Cdd:pfam07728   1 GVLLVGPPGTGKSELAER------LAAALSNRPVFYVQLTRDTTEEDLKGRRNIDPGGASWVDGplvraaregEIAVLDE 74
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85108961   417 FDKMSDIDRVAIHEVMEQQTVTIAKAG--IHTSLNARcSVIAAANPIfgqydtHKDPHKniaLPDSLLSRF 485
Cdd:pfam07728  75 INRANPDVLNSLLSLLDERRLLLPEGGelVKAAPDGF-RLIATMNPL------DRGLNE---LSPALRSRF 135
MCM smart00350
minichromosome maintenance proteins;
112-667 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 659.34  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    112 HTCNPRTLSSQHLNNMVSIEGIVTRTSLIRPKVVKS---VHYSEAKKTFHYREYRDQTMTngivtnSVYPREDEEGNPLE 188
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPT------VCPPRECQSPTPFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    189 TEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDRVKPGDRIQLVGIFRTL--GNRNTNHNS-ALFKTVILA 265
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpyGFKLNTVKGlPVFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    266 NNIVLLSSKS---GGGVATATITDTDIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEKNLENGTHLR 342
Cdd:smart00350 155 NHVRKLDYKRsfeDSSFSVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIR 234
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    343 GDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSD 422
Cdd:smart00350 235 GDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDD 314
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    423 IDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQ 502
Cdd:smart00350 315 SDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRE 394
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    503 VSEHVLRMHRYRQPgteegapvrenagqalnvalngqSESQKPTEMwekydamlhagikvpsgrgsankkpeiLSIPFMK 582
Cdd:smart00350 395 LAKHVVDLHRYSHP-----------------------EEDEAFEPP---------------------------LSQEKLR 424
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    583 KYIQYAKTRIKPVLTQEASDRIADIYVGLRNDDMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEERDAAAAESIL 662
Cdd:smart00350 425 KYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLL 504

                   ....*
gi 85108961    663 RFALF 667
Cdd:smart00350 505 RESII 509
MCM2 COG1241
Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, ...
18-677 0e+00

Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]


Pssm-ID: 224162 [Multi-domain]  Cd Length: 682  Bit Score: 608.19  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  18 AQEFLDPHDQHQRSYRPDIVLMLQKNQRRLVVNIDHVRDHSSEVAEGLLTDPFNWTLAFNHALKTIvstvpqARPDQIDP 97
Cdd:COG1241   4 AELFRLRFKWEDILEYAENIILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEI------ALLLFPEV 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  98 DVLYYCAWAGSFGLHTCNP-RTLSSQHLNNMVSIEGIVTRTSLIRPKVVKSVHYSEAKKTFHYREYRDqtmtNGIVTNSV 176
Cdd:COG1241  78 DRSLKKIHVRFKNLPNRLSiRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVEQSE----FRVEPPRE 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 177 YPREDEEG-NPLETEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDRVKPGDRIQLVGIFRT--LGNRNTN 253
Cdd:COG1241 154 CENCGKFGkGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIvpSRSLSGR 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 254 HNSALFKTVILANNIVLLSSKSgggvaTATITDTDIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEK 333
Cdd:COG1241 234 RKGPVFEIYLEANSVEKLDKRE-----EVEITEEDEEEIKELAKRPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKK 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 334 NLENGTHLRGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVC 413
Cdd:COG1241 309 NLPDGTRIRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCC 388
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 414 IDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTD 493
Cdd:COG1241 389 IDEFDKMNEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKD 468
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 494 DIEDTRDRQVSEHVLRMHRYRQPGTEEGAPVRENagqalnvalngqsesqkptemwekydamlhagikvpsgrgsankkP 573
Cdd:COG1241 469 DPDEEKDEEIAEHILDKHRGEEPEETISLDGVDE---------------------------------------------V 503
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 574 EILSIPFMKKYIQYAKTRIKPVLTQEASDRIADIYVGLRNDDMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEER 653
Cdd:COG1241 504 EERDFELLRKYISYARKNVTPVLTEEAREELEDYYVEMRKKSALVEEKRTIPITARQLESIIRLAEAHAKMRLSDVVEEE 583
                       650       660
                ....*....|....*....|....
gi 85108961 654 DAAAAESILRFALFKEVVQDESRK 677
Cdd:COG1241 584 DVDEAIRLVDFSLKTVAVDPEKGK 607
MCM pfam00493
MCM2/3/5 family;
288-666 7.16e-165

MCM2/3/5 family;


Pssm-ID: 249903 [Multi-domain]  Cd Length: 330  Bit Score: 488.23  E-value: 7.16e-165
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   288 DIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEKNLENGTHLRGDINILMVGDPSTAKSQLLRFVLNT 367
Cdd:pfam00493   1 DEEEIKELAKDPDIYDKLARSIAPSIYGHEDVKKAILLQLFGGVKKNTPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   368 APLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTS 447
Cdd:pfam00493  81 APRAVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVAT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   448 LNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQVSEHVLRMHRYRQPGTEEgapvren 527
Cdd:pfam00493 161 LNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNGEPSVEE------- 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   528 agqalnvalngqsesqkptemwekydamlhagikvpSGRGSANKKPEILsipfmKKYIQYAKTRIKPVLTQEASDRIADI 607
Cdd:pfam00493 234 ------------------------------------SIETEDYVDPELL-----RKYIAYARENIFPKLSEEAREKLVNY 272
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 85108961   608 YVGLRNddMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEERDAAAAESILRFAL 666
Cdd:pfam00493 273 YVELRK--ESTGKRKSIPITVRQLESLIRLSEAHARLRLSEEVTEEDVEEAIRLILESL 329
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
112-677 4.16e-76

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403 [Multi-domain]  Cd Length: 915  Bit Score: 268.40  E-value: 4.16e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  112 HTCNPRTLSSQHLNNMVSIEGIVTRTSLIRPKVVKSVHYSEAKKTFHYREYRDQT------MTNGIVTNSVYPREDEEGN 185
Cdd:PTZ00111 214 VSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEITMACFRCRGQKKIGLNDYQPCTcehyeyVIQGEVNEPLLCNECNSKY 293
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  186 PLETEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDR--------------------VKPGDRIQLVGIFR 245
Cdd:PTZ00111 294 TFELNHNMCVYSTKKIVKLLQSNSSLNNPDKDGLDNSVDNSGLNGEiymkdnevinlnlyddlidsVKTGDRVTVVGILK 373
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  246 T----LGNRNTNHNSaLFKTVILANNIVLLSSKSGGGVATA--------TITDTDIRNINKISKKPKVFELLSQSLAPSI 313
Cdd:PTZ00111 374 VtpirTSTTRRTLKS-LYTYFVNVIHVKVINSTNANQPEKGlkylgnenDFSDLQVYKILELSRNPMIYRILLDSFAPSI 452
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  314 YGHDYIKKAILLMLLGGMEKNLENGT---------HLRGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGL 384
Cdd:PTZ00111 453 KARNNVKIGLLCQLFSGNKNSSDFNKspdacykvdNFRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGL 532
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  385 TAAVT-SDKETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFG 463
Cdd:PTZ00111 533 TASIKfNESDNGRAMIQPGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINS 612
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  464 QYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQVSEHVLRmhryrqpgteegapvrenagqalNVALNGQSESQ 543
Cdd:PTZ00111 613 RYNKNKAVIENINISPSLFTRFDLIYLVLDHIDQDTDQLISLSIAK-----------------------DFLLPHMTGSG 669
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  544 KPTEMWEKYDAMLhagikVPSGRGSANKKPEILSIPFMKKYIQYAKTRIKPVLTQEASDRIADIYVGLR----------- 612
Cdd:PTZ00111 670 NDEDTYDRSNTMH-----VEDESLRSEKDYNKNDLDMLRMYIKFSKLHCFPKLSDEAKKVITREYVKMRqgnfqtsnlde 744
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 85108961  613 -------NDDMEGNQRKTSPM---TVRTLETLIRLATAHAKARLSNRVEERDAAAAESILRFALFKEVVQDESRK 677
Cdd:PTZ00111 745 lehaqedDDDDLYYQSSGTRMiyvSSRMISSIIRISVSLARMRLSTVVTPADALQAVQIVKSSTFQSLVDPTTGK 819
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
346-491 1.02e-03

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 39.44  E-value: 1.02e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 346 NILMVGDPSTAKSQLLRFVLNTAPLA----IATTGrgsSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMS 421
Cdd:cd00009  21 NLLLYGPPGTGKTTLARAIANELFRPgapfLYLNA---SDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLS 97
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 422 DIDRVAIHEVMEQQTVTIAKagihtslNARCSVIAAANPIFgqydthkdphkNIALPDSLLSRFDLLFVV 491
Cdd:cd00009  98 RGAQNALLRVLETLNDLRID-------RENVRVIGATNRPL-----------LGDLDRALYDRLDIRIVI 149
MCM_N pfam14551
MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region ...
14-132 1.43e-15

MCM N-terminal domain; This family contains the N-terminal region of MCM proteins. This region is composed of three structural domains. Firstly a four helical bundle, secondly a zinc binding motif and thirdly an OB-like fold.


Pssm-ID: 258689  Cd Length: 117  Bit Score: 74.56  E-value: 1.43e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    14 RVRQAQEFLD-PHDQHQRSYRPDIVLMLQKNQRRLVVNIDHVRDHSSEVAEGLLTDPFNWTLAFNHALKTIVSTVPQARP 92
Cdd:pfam14551   1 IKRRFREFLReFKGGGEPKYRDQLREMANREKRSLEVDLDDLREFDPELADALLENPQEYLPLFEEALKEVVLELDPFPP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 85108961    93 -DQIDPDVlyycaWAGSFGL-HTCNPRTLSSQHLNNMVSIEG 132
Cdd:pfam14551  81 eLKRRKEI-----QVRFYNLpKVVSIRDLRSSHIGKLVSVEG 117
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
346-485 1.12e-03

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 254388  Cd Length: 135  Bit Score: 38.82  E-value: 1.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   346 NILMVGDPSTAKSQLLRFvlntapLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADR---------GVVCIDE 416
Cdd:pfam07728   1 GVLLVGPPGTGKSELAER------LAAALSNRPVFYVQLTRDTTEEDLKGRRNIDPGGASWVDGplvraaregEIAVLDE 74
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 85108961   417 FDKMSDIDRVAIHEVMEQQTVTIAKAG--IHTSLNARcSVIAAANPIfgqydtHKDPHKniaLPDSLLSRF 485
Cdd:pfam07728  75 INRANPDVLNSLLSLLDERRLLLPEGGelVKAAPDGF-RLIATMNPL------DRGLNE---LSPALRSRF 135
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
402-460 7.39e-03

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 144608  Cd Length: 207  Bit Score: 37.49  E-value: 7.39e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 85108961   402 GAMVMADRGVVCIDE---FDKmsdidRV--AIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANP 460
Cdd:pfam01078 100 GEISLAHNGVLFLDElpeFSR-----RVleSLRQPLEDGEITISRARAKVTFPARFQLVAAMNP 158
MCM smart00350
minichromosome maintenance proteins;
112-667 0e+00

minichromosome maintenance proteins;


Pssm-ID: 214631 [Multi-domain]  Cd Length: 509  Bit Score: 659.34  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    112 HTCNPRTLSSQHLNNMVSIEGIVTRTSLIRPKVVKS---VHYSEAKKTFHYREYRDQTMTngivtnSVYPREDEEGNPLE 188
Cdd:smart00350   1 KPSSIRELRADHLGKLVRISGIVTRTSGVRPKLKRAsftCEKCGATLGPEIQSGRETEPT------VCPPRECQSPTPFS 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    189 TEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDRVKPGDRIQLVGIFRTL--GNRNTNHNS-ALFKTVILA 265
Cdd:smart00350  75 LNHERSTFIDFQKIKLQESPEEVPVGQLPRSVDVILDGDLVDKAKPGDRVEVTGIYRNVpyGFKLNTVKGlPVFATYIEA 154
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    266 NNIVLLSSKS---GGGVATATITDTDIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEKNLENGTHLR 342
Cdd:smart00350 155 NHVRKLDYKRsfeDSSFSVQSLSDEEEEEIRKLSKDPDIYERLARSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIR 234
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    343 GDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSD 422
Cdd:smart00350 235 GDINILLCGDPGTAKSQLLKYVEKTAPRAVYTTGKGSSAVGLTAAVTRDPETREFTLEAGALVLADNGVCCIDEFDKMDD 314
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    423 IDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQ 502
Cdd:smart00350 315 SDRTAIHEAMEQQTISIAKAGITTTLNARCSVLAAANPIGGRYDPKLTPEENIDLPAPILSRFDLLFVVLDEVDEERDRE 394
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    503 VSEHVLRMHRYRQPgteegapvrenagqalnvalngqSESQKPTEMwekydamlhagikvpsgrgsankkpeiLSIPFMK 582
Cdd:smart00350 395 LAKHVVDLHRYSHP-----------------------EEDEAFEPP---------------------------LSQEKLR 424
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961    583 KYIQYAKTRIKPVLTQEASDRIADIYVGLRNDDMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEERDAAAAESIL 662
Cdd:smart00350 425 KYIAYAREKIKPKLSEEAADKLVKAYVDLRKEDSQTESRSSIPITVRQLESIIRLSEAHAKMRLSDVVEEADVEEAIRLL 504

                   ....*
gi 85108961    663 RFALF 667
Cdd:smart00350 505 RESII 509
MCM2 COG1241
Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, ...
18-677 0e+00

Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]


Pssm-ID: 224162 [Multi-domain]  Cd Length: 682  Bit Score: 608.19  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  18 AQEFLDPHDQHQRSYRPDIVLMLQKNQRRLVVNIDHVRDHSSEVAEGLLTDPFNWTLAFNHALKTIvstvpqARPDQIDP 97
Cdd:COG1241   4 AELFRLRFKWEDILEYAENIILDKIINRSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEI------ALLLFPEV 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  98 DVLYYCAWAGSFGLHTCNP-RTLSSQHLNNMVSIEGIVTRTSLIRPKVVKSVHYSEAKKTFHYREYRDqtmtNGIVTNSV 176
Cdd:COG1241  78 DRSLKKIHVRFKNLPNRLSiRELRSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEVEQSE----FRVEPPRE 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 177 YPREDEEG-NPLETEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDRVKPGDRIQLVGIFRT--LGNRNTN 253
Cdd:COG1241 154 CENCGKFGkGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDRVKITGVVRIvpSRSLSGR 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 254 HNSALFKTVILANNIVLLSSKSgggvaTATITDTDIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEK 333
Cdd:COG1241 234 RKGPVFEIYLEANSVEKLDKRE-----EVEITEEDEEEIKELAKRPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKK 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 334 NLENGTHLRGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVC 413
Cdd:COG1241 309 NLPDGTRIRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGGVCC 388
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 414 IDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTD 493
Cdd:COG1241 389 IDEFDKMNEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANPKFGRYDPKKTVAENINLPAPLLSRFDLIFVLKD 468
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 494 DIEDTRDRQVSEHVLRMHRYRQPGTEEGAPVRENagqalnvalngqsesqkptemwekydamlhagikvpsgrgsankkP 573
Cdd:COG1241 469 DPDEEKDEEIAEHILDKHRGEEPEETISLDGVDE---------------------------------------------V 503
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 574 EILSIPFMKKYIQYAKTRIKPVLTQEASDRIADIYVGLRNDDMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEER 653
Cdd:COG1241 504 EERDFELLRKYISYARKNVTPVLTEEAREELEDYYVEMRKKSALVEEKRTIPITARQLESIIRLAEAHAKMRLSDVVEEE 583
                       650       660
                ....*....|....*....|....
gi 85108961 654 DAAAAESILRFALFKEVVQDESRK 677
Cdd:COG1241 584 DVDEAIRLVDFSLKTVAVDPEKGK 607
MCM pfam00493
MCM2/3/5 family;
288-666 7.16e-165

MCM2/3/5 family;


Pssm-ID: 249903 [Multi-domain]  Cd Length: 330  Bit Score: 488.23  E-value: 7.16e-165
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   288 DIRNINKISKKPKVFELLSQSLAPSIYGHDYIKKAILLMLLGGMEKNLENGTHLRGDINILMVGDPSTAKSQLLRFVLNT 367
Cdd:pfam00493   1 DEEEIKELAKDPDIYDKLARSIAPSIYGHEDVKKAILLQLFGGVKKNTPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   368 APLAIATTGRGSSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTS 447
Cdd:pfam00493  81 APRAVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGALVLADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVAT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   448 LNARCSVIAAANPIFGQYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQVSEHVLRMHRYRQPGTEEgapvren 527
Cdd:pfam00493 161 LNARCSVLAAANPIFGRYDPKKSVAENINLPPPLLSRFDLIFVLLDKPDEEKDERLAKHIVDLHRNGEPSVEE------- 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961   528 agqalnvalngqsesqkptemwekydamlhagikvpSGRGSANKKPEILsipfmKKYIQYAKTRIKPVLTQEASDRIADI 607
Cdd:pfam00493 234 ------------------------------------SIETEDYVDPELL-----RKYIAYARENIFPKLSEEAREKLVNY 272
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 85108961   608 YVGLRNddMEGNQRKTSPMTVRTLETLIRLATAHAKARLSNRVEERDAAAAESILRFAL 666
Cdd:pfam00493 273 YVELRK--ESTGKRKSIPITVRQLESLIRLSEAHARLRLSEEVTEEDVEEAIRLILESL 329
PTZ00111 PTZ00111
DNA replication licensing factor MCM4; Provisional
112-677 4.16e-76

DNA replication licensing factor MCM4; Provisional


Pssm-ID: 173403 [Multi-domain]  Cd Length: 915  Bit Score: 268.40  E-value: 4.16e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  112 HTCNPRTLSSQHLNNMVSIEGIVTRTSLIRPKVVKSVHYSEAKKTFHYREYRDQT------MTNGIVTNSVYPREDEEGN 185
Cdd:PTZ00111 214 VSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEITMACFRCRGQKKIGLNDYQPCTcehyeyVIQGEVNEPLLCNECNSKY 293
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  186 PLETEYGFSTYRDHQTISIQEMPERAPAGQLPRGVDVILDDDLVDR--------------------VKPGDRIQLVGIFR 245
Cdd:PTZ00111 294 TFELNHNMCVYSTKKIVKLLQSNSSLNNPDKDGLDNSVDNSGLNGEiymkdnevinlnlyddlidsVKTGDRVTVVGILK 373
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  246 T----LGNRNTNHNSaLFKTVILANNIVLLSSKSGGGVATA--------TITDTDIRNINKISKKPKVFELLSQSLAPSI 313
Cdd:PTZ00111 374 VtpirTSTTRRTLKS-LYTYFVNVIHVKVINSTNANQPEKGlkylgnenDFSDLQVYKILELSRNPMIYRILLDSFAPSI 452
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  314 YGHDYIKKAILLMLLGGMEKNLENGT---------HLRGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGL 384
Cdd:PTZ00111 453 KARNNVKIGLLCQLFSGNKNSSDFNKspdacykvdNFRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGL 532
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  385 TAAVT-SDKETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANPIFG 463
Cdd:PTZ00111 533 TASIKfNESDNGRAMIQPGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINS 612
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  464 QYDTHKDPHKNIALPDSLLSRFDLLFVVTDDIEDTRDRQVSEHVLRmhryrqpgteegapvrenagqalNVALNGQSESQ 543
Cdd:PTZ00111 613 RYNKNKAVIENINISPSLFTRFDLIYLVLDHIDQDTDQLISLSIAK-----------------------DFLLPHMTGSG 669
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961  544 KPTEMWEKYDAMLhagikVPSGRGSANKKPEILSIPFMKKYIQYAKTRIKPVLTQEASDRIADIYVGLR----------- 612
Cdd:PTZ00111 670 NDEDTYDRSNTMH-----VEDESLRSEKDYNKNDLDMLRMYIKFSKLHCFPKLSDEAKKVITREYVKMRqgnfqtsnlde 744
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 85108961  613 -------NDDMEGNQRKTSPM---TVRTLETLIRLATAHAKARLSNRVEERDAAAAESILRFALFKEVVQDESRK 677
Cdd:PTZ00111 745 lehaqedDDDDLYYQSSGTRMiyvSSRMISSIIRISVSLARMRLSTVVTPADALQAVQIVKSSTFQSLVDPTTGK 819
COG0714 COG0714
MoxR-like ATPases [General function prediction only]
305-491 2.05e-06

MoxR-like ATPases [General function prediction only]


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 49.36  E-value: 2.05e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 305 LSQSLAPSIYGHDYIKKAILL-MLLGGmeknlengthlrgdiNILMVGDPSTAKSQLLR---FVLNTAPLAIATT--GRG 378
Cdd:COG0714  18 IRSELEKVVVGDEEVIELALLaLLAGG---------------HVLLEGPPGVGKTLLARalaRALGLPFVRIQCTpdLLP 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85108961 379 SSGVGLTAAVTSDKETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIakaGIHTSLNARCS--VIA 456
Cdd:COG0714  83 SDLLGTYAYAALLLEPGEFRFVPGPLFAAVRVILLLDEINRAPPEVQNALLEALEERQVTV---PGLTTIRLPPPfiVIA 159
                       170       180       190
                ....*....|....*....|....*....|....*
gi 85108961 457 AANPIFgQYDTHkdphkniALPDSLLSRFDLLFVV 491
Cdd:COG0714 160 TQNPGE-YEGTY-------PLPEALLDRFLLRIYV 186
ChlI COG1239
Mg-chelatase subunit ChlI [Coenzyme metabolism]
392-460 2.06e-05

Mg-chelatase subunit ChlI [Coenzyme metabolism]


Pssm-ID: 224160 [Multi-domain]  Cd Length: 423  Bit Score: 46.63  E-value: 2.06e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 85108961 392 KETGERRLEAGAMVMADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVIAAANP 460
Cdd:COG1239 128 LEEGPKAFQPGLLARANRGILYVDEVNLLDDHLVDALLDVAAEGVNDVEREGISIRHPARFLLIGTMNP 196
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH