NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83589252|ref|YP_429261|]
View 

methyl-accepting chemotaxis sensory transducer [Moorella thermoacetica ATCC 39073]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
140-367 1.10e-46

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 162.79  E-value: 1.10e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 140 DEEAGATQRVAENVEALTALAKDIAHLSsegvnlvgeakrreEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKV 219
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELA--------------EKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEI 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 220 NEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRL 299
Cdd:cd11386  67 GEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 83589252 300 VKDNLEQGEETMRemeevteaftrvagAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVT 367
Cdd:cd11386 147 VEEGVELVEETGR--------------AFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
127-384 1.28e-55

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 189.03  E-value: 1.28e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    127 EIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAA 206
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    207 EKVMRLEVKIEKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVA 286
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    287 KEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEV 366
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*...
gi 83589252    367 TASVAHQEMAMETMEESV 384
Cdd:smart00283 241 SAAAEELSGLAEELDELV 258
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
140-367 1.10e-46

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 162.79  E-value: 1.10e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 140 DEEAGATQRVAENVEALTALAKDIAHLSsegvnlvgeakrreEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKV 219
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELA--------------EKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEI 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 220 NEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRL 299
Cdd:cd11386  67 GEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 83589252 300 VKDNLEQGEETMRemeevteaftrvagAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVT 367
Cdd:cd11386 147 VEEGVELVEETGR--------------AFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
127-384 1.28e-55

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 189.03  E-value: 1.28e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    127 EIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAA 206
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    207 EKVMRLEVKIEKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVA 286
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    287 KEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEV 366
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*...
gi 83589252    367 TASVAHQEMAMETMEESV 384
Cdd:smart00283 241 SAAAEELSGLAEELDELV 258
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
82-384 2.05e-48

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 173.64  E-value: 2.05e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  82 FHEIAGRVLEAFFRMIGNMQRssdelnyLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAK 161
Cdd:COG0840 111 SNDEFGQLAKSFNEMILNLRQ-------IIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVK 183
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 162 DIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRyvtEITDQTNLLALNAA 241
Cdd:COG0840 184 EVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVIN---SIAEQTNLLALNAA 260
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 242 IEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAF 321
Cdd:COG0840 261 IEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAI 340
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83589252 322 TRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV 384
Cdd:COG0840 341 EEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELV 403
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
182-384 1.33e-39

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 143.35  E-value: 1.33e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   182 EKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEV 261
Cdd:pfam00015   5 DLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   262 RKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAER 341
Cdd:pfam00015  85 RKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAG 164
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 83589252   342 AQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV 384
Cdd:pfam00015 165 IDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASV 207
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
26-391 8.56e-33

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 130.19  E-value: 8.56e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   26 LVMVLVGILLssTGAFLLWQR--WIHPLLLLQRFLSLLEKGD---PVAAekflkaqkwsRGFHEIAgrvleAFFRMIGNM 100
Cdd:PRK09793 193 ISMIIVAAIY--ISSALWWTRkmIVQPLAIIGSHFDSIAAGNlarPIAV----------YGRNEIT-----AIFASLKTM 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  101 QRSsdeLNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRR 180
Cdd:PRK09793 256 QQA---LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATT 332
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  181 EEKGREVLKVLLANMERAAVSIEeaaekvmrlevkieKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGE 260
Cdd:PRK09793 333 AQAGGVQVSTMTHTMQEIATSSQ--------------KIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE 398
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  261 VRKLAERSAQAAQNIVRIAEtiqevakEAAKQVEENVRLVkdnleqgEETMREMEEVTEAFTRVAGAMEEIYSNARKQAE 340
Cdd:PRK09793 399 VRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLV-------NNAAATMTDIVSSVTRVNDIMGEIASASEEQRR 464
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  341 RAQNINQDASHMAAVAQETAAGVEEVTAS---VAHQE------MAMETMEESVVKLSDMA 391
Cdd:PRK09793 465 GIEQVAQAVSQMDQVTQQNASLVEEAAVAteqLANQAdhlssrVAVFTLEEHEVARHESA 524
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
116-399 8.00e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 50.44  E-value: 8.00e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    116 REAEANRVSL-AEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHL----------SSEGVNLVGEAKRREEKG 184
Cdd:TIGR02168  666 AKTNSSILERrREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLrkeleelsrqISALRKDLARLEAEVEQL 745
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    185 REVLKVLLANMERAAVSIEEAAEKV-------MRLEVKIEKVNEFVRyvteiTDQTNLLALNAAIEAARAGdsgrgFAVV 257
Cdd:TIGR02168  746 EERIAQLSKELTELEAEIEELEERLeeaeeelAEAEAEIEELEAQIE-----QLKEELKALREALDELRAE-----LTLL 815
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    258 AGEVRKLAERSAQAAQNIVRIAETIQEVAKEAaKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARK 337
Cdd:TIGR02168  816 NEEAANLRERLESLERRIAATERRLEDLEEQI-EELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRS 894
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 83589252    338 QAERAQNINQDASHmaaVAQETAAGVEEVTASVAHQEMAMETMEesvVKLSDMAGRFDELAN 399
Cdd:TIGR02168  895 ELEELSEELRELES---KRSELRRELEELREKLAQLELRLEGLE---VRIDNLQERLSEEYS 950
PTZ00121 PTZ00121
MAEBL; Provisional
69-446 6.48e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 6.48e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    69 AEKFLKAQKWSRGfhEIAGRVLEAffRMIGNMQRSSDelnylvgviQREAEANRvsLAEIARTMQDMAGGADEEAGATQR 148
Cdd:PTZ00121 1142 AEEARKAEDAKRV--EIARKAEDA--RKAEEARKAED---------AKKAEAAR--KAEEVRKAEELRKAEDARKAEAAR 1206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   149 VAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVN--EFVRYV 226
Cdd:PTZ00121 1207 KAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARkaDELKKA 1286
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   227 TEItdqtnllalNAAIEAARAGDSGRgfavvAGEVRKLAERsAQAAQNIVRIAETIQEVAKEAAKQVEENVRlvKDNLEQ 306
Cdd:PTZ00121 1287 EEK---------KKADEAKKAEEKKK-----ADEAKKKAEE-AKKADEAKKKAEEAKKKADAAKKKAEEAKK--AAEAAK 1349
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   307 GEETMREMEevTEAFTRVAGAMEEIYSNARKQAERAQNINQD---ASHMAAVAQETAAGVEEVTASVAHQEMAMETME-- 381
Cdd:PTZ00121 1350 AEAEAAADE--AEAAEEKAEAAEKKKEEAKKKADAAKKKAEEkkkADEAKKKAEEDKKKADELKKAAAAKKKADEAKKka 1427
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 83589252   382 ESVVKLSDMAGRFDElanqytKEGWDEATKNSLIQNGMQILKSLAENSEiksmQIEKLRKPFDEA 446
Cdd:PTZ00121 1428 EEKKKADEAKKKAEE------AKKADEAKKKAEEAKKAEEAKKKAEEAK----KADEAKKKAEEA 1482
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
140-367 1.10e-46

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 162.79  E-value: 1.10e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 140 DEEAGATQRVAENVEALTALAKDIAHLSsegvnlvgeakrreEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKV 219
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELA--------------EKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEI 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 220 NEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRL 299
Cdd:cd11386  67 GEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEE 146
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 83589252 300 VKDNLEQGEETMRemeevteaftrvagAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVT 367
Cdd:cd11386 147 VEEGVELVEETGR--------------AFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
127-384 1.28e-55

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 189.03  E-value: 1.28e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    127 EIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAA 206
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    207 EKVMRLEVKIEKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVA 286
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    287 KEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEV 366
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*...
gi 83589252    367 TASVAHQEMAMETMEESV 384
Cdd:smart00283 241 SAAAEELSGLAEELDELV 258
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
82-384 2.05e-48

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 173.64  E-value: 2.05e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  82 FHEIAGRVLEAFFRMIGNMQRssdelnyLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAK 161
Cdd:COG0840 111 SNDEFGQLAKSFNEMILNLRQ-------IIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVK 183
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 162 DIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRyvtEITDQTNLLALNAA 241
Cdd:COG0840 184 EVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITSVIN---SIAEQTNLLALNAA 260
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 242 IEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAF 321
Cdd:COG0840 261 IEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAI 340
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83589252 322 TRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV 384
Cdd:COG0840 341 EEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELV 403
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
182-384 1.33e-39

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 143.35  E-value: 1.33e-39
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   182 EKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGEV 261
Cdd:pfam00015   5 DLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   262 RKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAER 341
Cdd:pfam00015  85 RKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAG 164
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 83589252   342 AQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV 384
Cdd:pfam00015 165 IDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASV 207
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
26-391 8.56e-33

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 130.19  E-value: 8.56e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   26 LVMVLVGILLssTGAFLLWQR--WIHPLLLLQRFLSLLEKGD---PVAAekflkaqkwsRGFHEIAgrvleAFFRMIGNM 100
Cdd:PRK09793 193 ISMIIVAAIY--ISSALWWTRkmIVQPLAIIGSHFDSIAAGNlarPIAV----------YGRNEIT-----AIFASLKTM 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  101 QRSsdeLNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRR 180
Cdd:PRK09793 256 QQA---LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATT 332
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  181 EEKGREVLKVLLANMERAAVSIEeaaekvmrlevkieKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVAGE 260
Cdd:PRK09793 333 AQAGGVQVSTMTHTMQEIATSSQ--------------KIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE 398
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  261 VRKLAERSAQAAQNIVRIAEtiqevakEAAKQVEENVRLVkdnleqgEETMREMEEVTEAFTRVAGAMEEIYSNARKQAE 340
Cdd:PRK09793 399 VRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLV-------NNAAATMTDIVSSVTRVNDIMGEIASASEEQRR 464
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  341 RAQNINQDASHMAAVAQETAAGVEEVTAS---VAHQE------MAMETMEESVVKLSDMA 391
Cdd:PRK09793 465 GIEQVAQAVSQMDQVTQQNASLVEEAAVAteqLANQAdhlssrVAVFTLEEHEVARHESA 524
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
99-384 6.84e-31

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 124.68  E-value: 6.84e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   99 NMQRSSDELNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAK 178
Cdd:PRK15041 255 SLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSAS 334
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  179 RREEKGREVLKVLLANMERAAVSIEeaaekvmrlevkieKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGFAVVA 258
Cdd:PRK15041 335 ETAQRGGKVVDNVVQTMRDISTSSQ--------------KIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA 400
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  259 GEVRKLAERSAQAAQNIVRIAEtiqevakEAAKQVEENVRLVkdnlEQGEETmreMEEVTEAFTRVAGAMEEIYSNARKQ 338
Cdd:PRK15041 401 GEVRNLAQRSAQAAREIKSLIE-------DSVGKVDVGSTLV----ESAGET---MAEIVSAVTRVTDIMGEIASASDEQ 466
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 83589252  339 AERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV 384
Cdd:PRK15041 467 SRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAV 512
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
95-374 2.10e-28

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 117.80  E-value: 2.10e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   95 RMIGNMQRSsdeLNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLV 174
Cdd:PRK15048 252 QSVSHMQRS---LTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLA 328
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  175 GEAKRREEKGREVLKVLLANMERAAVSIEeaaekvmrlevkieKVNEFVRYVTEITDQTNLLALNAAIEAARAGDSGRGF 254
Cdd:PRK15048 329 QSASDTAQHGGKVVDGVVKTMHEIADSSK--------------KIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGF 394
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  255 AVVAGEVRKLAERSAQAAQNIVRIAEtiqevakEAAKQVEENVRLVkdnlEQGEETMRemeEVTEAFTRVAGAMEEIYSN 334
Cdd:PRK15048 395 AVVAGEVRNLASRSAQAAKEIKALIE-------DSVSRVDTGSVLV----ESAGETMN---NIVNAVTRVTDIMGEIASA 460
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 83589252  335 ARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQE 374
Cdd:PRK15048 461 SDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALE 500
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
116-399 8.00e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 50.44  E-value: 8.00e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    116 REAEANRVSL-AEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHL----------SSEGVNLVGEAKRREEKG 184
Cdd:TIGR02168  666 AKTNSSILERrREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLrkeleelsrqISALRKDLARLEAEVEQL 745
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    185 REVLKVLLANMERAAVSIEEAAEKV-------MRLEVKIEKVNEFVRyvteiTDQTNLLALNAAIEAARAGdsgrgFAVV 257
Cdd:TIGR02168  746 EERIAQLSKELTELEAEIEELEERLeeaeeelAEAEAEIEELEAQIE-----QLKEELKALREALDELRAE-----LTLL 815
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    258 AGEVRKLAERSAQAAQNIVRIAETIQEVAKEAaKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARK 337
Cdd:TIGR02168  816 NEEAANLRERLESLERRIAATERRLEDLEEQI-EELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRS 894
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 83589252    338 QAERAQNINQDASHmaaVAQETAAGVEEVTASVAHQEMAMETMEesvVKLSDMAGRFDELAN 399
Cdd:TIGR02168  895 ELEELSEELRELES---KRSELRRELEELREKLAQLELRLEGLE---VRIDNLQERLSEEYS 950
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
151-400 1.03e-06

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 49.60  E-value: 1.03e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 151 ENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEIT 230
Cdd:COG0840   4 EAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRA 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 231 DQTNLLALNAAIEAARAGD-SGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEE 309
Cdd:COG0840  84 ILEPISDLLEVVERIAAGDlTKRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQ 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252 310 TMREMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHqemAMETMEESVVKLSD 389
Cdd:COG0840 164 QAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAE---VVKKLSESSQEIEE 240
                       250
                ....*....|.
gi 83589252 390 MAGRFDELANQ 400
Cdd:COG0840 241 ITSVINSIAEQ 251
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
174-441 1.10e-05

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 47.02  E-value: 1.10e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  174 VGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEITD------QTNLLALNAAIEAARa 247
Cdd:COG1196  167 VSKYKERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRElelallLAKLKELRKELEELE- 245
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  248 gdsgRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLvKDNLEQGEETMREMEEVTEaftRVAGA 327
Cdd:COG1196  246 ----EELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLEL-KEEIEELEGEISLLRERLE---ELENE 317
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  328 MEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESVVKlsdmagRFDELANQYTKEGWD 407
Cdd:COG1196  318 LEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEE------LFEALREELAELEAE 391
                        250       260       270
                 ....*....|....*....|....*....|....
gi 83589252  408 EATKNSLIQNGMQILKSLAENSEIKSMQIEKLRK 441
Cdd:COG1196  392 LAEIRNELEELKREIESLEERLERLSERLEDLKE 425
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
174-440 3.59e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 45.44  E-value: 3.59e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    174 VGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEITDQ------TNLLALNAAIEAARA 247
Cdd:TIGR02169  165 VAEFDRKKEKALEELEEVEENIERLDLIIDEKRQQLERLRREREKAERYQALLKEKREYegyellKEKEALERQKEAIER 244
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    248 GDSG--RGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREME-EVTEAFTRV 324
Cdd:TIGR02169  245 QLASleEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKErELEDAEERL 324
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    325 AGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESVVKLSDMAGRFDELANQytke 404
Cdd:TIGR02169  325 AKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKRE---- 400
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 83589252    405 gwdeatKNSLIQNgmqiLKSLAENSEIKSMQIEKLR 440
Cdd:TIGR02169  401 ------INELKRE----LDRLQEELQRLSEELADLN 426
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
90-388 5.53e-05

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 44.80  E-value: 5.53e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252     90 LEAFFRMIGNMqrSSDELNYLVGVIQREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEA-------LTALAKD 162
Cdd:TIGR02680  242 LEALERALRNF--LQRYRRYARTMLRRRATRLRSAQTQYDQLSRDLGRARDELETAREEERELDARtealereADALRTR 319
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    163 IAHLSSEGVnlVGEAKRREEKGREVLkvllANMERAAVSIEEAAEKVMRLEvkiekvnEFVRYVTEitdqtnllalnaai 242
Cdd:TIGR02680  320 LEALQGSPA--YQDAEELERARADAE----ALQAAAADARQAIREAESRLE-------EERRRLDE-------------- 372
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    243 EAARAGDSGRGFAVVAGEVRKLAERSA-----QAAQNIVRIAETIQEV-----AKEAAKQVEENVRlvkdnlEQGEETMR 312
Cdd:TIGR02680  373 EAGRLDDAERELRAAREQLARAAERAGlspahTAEPDAALAAQELQELgaldaRRQDADRVIAQRS------EQVALLRR 446
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    313 EMEEVTEAFTRVAGA------MEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTA-SVAHQEMAMETMEESVV 385
Cdd:TIGR02680  447 RDDVADRAEATHAAArarrdeLDEEAEQAAARAELADEAVHREGARLAWVDAWQAQLRELTIlAVDDQPGALADLDSWDA 526

                   ...
gi 83589252    386 KLS 388
Cdd:TIGR02680  527 LLQ 529
PTZ00121 PTZ00121
MAEBL; Provisional
69-446 6.48e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 6.48e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    69 AEKFLKAQKWSRGfhEIAGRVLEAffRMIGNMQRSSDelnylvgviQREAEANRvsLAEIARTMQDMAGGADEEAGATQR 148
Cdd:PTZ00121 1142 AEEARKAEDAKRV--EIARKAEDA--RKAEEARKAED---------AKKAEAAR--KAEEVRKAEELRKAEDARKAEAAR 1206
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   149 VAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVN--EFVRYV 226
Cdd:PTZ00121 1207 KAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARkaDELKKA 1286
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   227 TEItdqtnllalNAAIEAARAGDSGRgfavvAGEVRKLAERsAQAAQNIVRIAETIQEVAKEAAKQVEENVRlvKDNLEQ 306
Cdd:PTZ00121 1287 EEK---------KKADEAKKAEEKKK-----ADEAKKKAEE-AKKADEAKKKAEEAKKKADAAKKKAEEAKK--AAEAAK 1349
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   307 GEETMREMEevTEAFTRVAGAMEEIYSNARKQAERAQNINQD---ASHMAAVAQETAAGVEEVTASVAHQEMAMETME-- 381
Cdd:PTZ00121 1350 AEAEAAADE--AEAAEEKAEAAEKKKEEAKKKADAAKKKAEEkkkADEAKKKAEEDKKKADELKKAAAAKKKADEAKKka 1427
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 83589252   382 ESVVKLSDMAGRFDElanqytKEGWDEATKNSLIQNGMQILKSLAENSEiksmQIEKLRKPFDEA 446
Cdd:PTZ00121 1428 EEKKKADEAKKKAEE------AKKADEAKKKAEEAKKAEEAKKKAEEAK----KADEAKKKAEEA 1482
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
135-451 9.72e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 43.89  E-value: 9.72e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    135 MAGGADEEAGAT----QRVAENVEALTALAKDIAHLSSEgvnlVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVM 210
Cdd:TIGR02168  661 ITGGSAKTNSSIlerrREIEELEEKIEELEEKIAELEKA----LAELRKELEELEEELEQLRKELEELSRQISALRKDLA 736
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    211 RLEVKIEKVNEFVRYVteitdQTNLLALNAAIEAARAgdsgrgfavvagEVRKLAERSAQAAQNIVRIAETIQEVAKEAA 290
Cdd:TIGR02168  737 RLEAEVEQLEERIAQL-----SKELTELEAEIEELEE------------RLEEAEEELAEAEAEIEELEAQIEQLKEELK 799
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    291 KQ------VEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAER-AQNINQDASHMAAVAQETAAGV 363
Cdd:TIGR02168  800 ALrealdeLRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESlAAEIEELEELIEELESELEALL 879
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    364 EEVTASVAHQEMAMETMEESVVKLSDMAGRFDELANQY----TKEGWDEATKNSLIQNGMQILKSLAENSEIKSMQIEKL 439
Cdd:TIGR02168  880 NERASLEEALALLRSELEELSEELRELESKRSELRRELeelrEKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEAL 959
                          330
                   ....*....|..
gi 83589252    440 RKPFDEAVAGLD 451
Cdd:TIGR02168  960 ENKIEDDEEEAR 971
recN TIGR00634
DNA repair protein RecN; All proteins in this family for which functions are known are ATP ...
120-432 1.13e-04

DNA repair protein RecN; All proteins in this family for which functions are known are ATP binding proteins involved in the initiation of recombination and recombinational repair [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 233065 [Multi-domain]  Cd Length: 563  Bit Score: 43.57  E-value: 1.13e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   120 ANRVSLAEIARTMQDMAGgadeeAGATQRVAENVEALTALAKDIAHlssegvnlvGEAKRREEKGREVLKVLLANMERAA 199
Cdd:TIGR00634 116 VSASSLLEFTSELLDLHG-----QHDQQLLFRPDEQRQLLDTFAGA---------NEKVKAYRELYQAWLKARQQLKDRQ 181
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   200 VSIEEAAEKVMRLEVKIEKV-------NEFVRYVTEITDQTNLLALNAAIEAARAGDSGrgfavvagevrklaERSAQAA 272
Cdd:TIGR00634 182 QKEQELAQRLDFLQFQLEELeeadlqpGEDEALEAEQQRLSNLEKLRELSQNALAALRG--------------DVDVQEG 247
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   273 QNIVRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEaftrvagameeiysNARKQAERAQNINQDASHM 352
Cdd:TIGR00634 248 SLLEGLGEAQLALASVIDGSLRELAEQVGNALTEVEEATRELQNYLD--------------ELEFDPERLNEIEERLAQI 313
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   353 AAVAQETAAGVEEVTASVAHQEMAMETMEESVVKLSDMAGRFDELANQYTKEGWD-----EATKNSLIQNGMQILKSLA- 426
Cdd:TIGR00634 314 KRLKRKYGASVEEVLEYAEKIKEELDQLDDSDESLEALEEEVDKLEEELDKAAVAlslirRKAAERLAKRVEQELKALAm 393

                  ....*.
gi 83589252   427 ENSEIK 432
Cdd:TIGR00634 394 EKAEFT 399
PTZ00121 PTZ00121
MAEBL; Provisional
140-446 1.28e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 43.59  E-value: 1.28e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   140 DEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKiEKV 219
Cdd:PTZ00121 1239 AEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAEEA-KKA 1317
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   220 NEFVRYVTEITDQTNLLALNAAiEAARAGDSGRGFAVVAGEVRKLAERSAQAAQnivRIAETIQEVAKEAAKQVEEnVRL 299
Cdd:PTZ00121 1318 DEAKKKAEEAKKKADAAKKKAE-EAKKAAEAAKAEAEAAADEAEAAEEKAEAAE---KKKEEAKKKADAAKKKAEE-KKK 1392
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   300 VKDNLEQGEETMREMEEVTEAFTRVAGAMEeiysnARKQAE---RAQNINQDASHmAAVAQETAAGVEEVTASVAHQEMA 376
Cdd:PTZ00121 1393 ADEAKKKAEEDKKKADELKKAAAAKKKADE-----AKKKAEekkKADEAKKKAEE-AKKADEAKKKAEEAKKAEEAKKKA 1466
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83589252   377 METME-ESVVKLSDMAGRFDELAN--QYTKEGWDEATKNSLIQNGMQILKSLAENSEIKSMQIEKLRKPFDEA 446
Cdd:PTZ00121 1467 EEAKKaDEAKKKAEEAKKADEAKKkaEEAKKKADEAKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEA 1539
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
90-349 1.37e-04

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 43.55  E-value: 1.37e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   90 LEAFFRMIGNMQRSSDELNYLVGVIQREAEANRVSLAEIartmqdmaggadeeagaTQRVAENVEALTALAKDIAHLSSE 169
Cdd:COG1196  241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEEL-----------------REELEELQEELLELKEEIEELEGE 303
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  170 GVNLVGEAKRREEKGREVLKVLLANMERaavsIEEAAEKVMRLEVKIEKVNEfvryvtEITDQTNLLALNAAIEAARAGD 249
Cdd:COG1196  304 ISLLRERLEELENELEELEERLEELKEK----IEALKEELEERETLLEELEQ------LLAELEEAKEELEEKLSALLEE 373
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  250 SGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAK---QVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAG 326
Cdd:COG1196  374 LEELFEALREELAELEAELAEIRNELEELKREIESLEERLERlseRLEDLKEELKELEAELEELQTELEELNEELEELEE 453
                        250       260
                 ....*....|....*....|...
gi 83589252  327 AMEEiYSNARKQAERAQNINQDA 349
Cdd:COG1196  454 QLEE-LRDRLKELERELAELQEE 475
PTZ00121 PTZ00121
MAEBL; Provisional
115-424 1.37e-04

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 43.59  E-value: 1.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   115 QREAEANRVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVGEAKRREE-------KGREV 187
Cdd:PTZ00121 1507 EAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEdknmalrKAEEA 1586
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   188 LKVLLANMERAAVSIEEA----AEKVMRLEVKIEKVNEfVRYVTEITDQTNLLALNAAIEAARAGD---SGRGFAVVAGE 260
Cdd:PTZ00121 1587 KKAEEARIEEVMKLYEEEkkmkAEEAKKAEEAKIKAEE-LKKAEEEKKKVEQLKKKEAEEKKKAEElkkAEEENKIKAAE 1665
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   261 VRKLAERSAQAAQNIvRIAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNARKQAE 340
Cdd:PTZ00121 1666 EAKKAEEDKKKAEEA-KKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKK 1744
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   341 RAQNINQD------ASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESVVKLSDMAGRFDELAN------------QYT 402
Cdd:PTZ00121 1745 KAEEAKKDeeekkkIAHLKKEEEKKAEEIRKEKEAVIEEELDEEDEKRRMEVDKKIKDIFDNFANiieggkegnlviNDS 1824
                         330       340
                  ....*....|....*....|..
gi 83589252   403 KEGWDEATKNSLIQNGMQILKS 424
Cdd:PTZ00121 1825 KEMEDSAIKEVADSKNMQLEEA 1846
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
106-375 3.55e-04

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.01  E-value: 3.55e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  106 ELNYLVGVIQREAEANRVSLAEIARTMQDMAggaDEEAGATQRVAENVEALTALAKDIAHLSSEGVNLVG---EAKRREE 182
Cdd:COG1196  671 ELEEELAELEAQLEKLEEELKSLKNELRSLE---DLLEELRRQLEELERQLEELKRELAALEEELEQLQSrleELEEELE 747
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  183 KGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEFVRYVTEitdqtNLLALNAAIEAARagdsgRGFAVVAGEVR 262
Cdd:COG1196  748 ELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQE-----ELEELEEELEEAE-----RRLDALERELE 817
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  263 KLAERSAQAAQNIVRIAETIQEVA------KEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAMEEIYSNAR 336
Cdd:COG1196  818 SLEQRRERLEQEIEELEEEIEELEekldelEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELE 897
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 83589252  337 KQAERAQNINQDASHMaAVAQETAAGVEEVTASVAHQEM 375
Cdd:COG1196  898 SELAELKEEIEKLRER-LEELEAKLERLEVELPELEEEL 935
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
117-447 8.48e-04

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219 [Multi-domain]  Cd Length: 787  Bit Score: 40.86  E-value: 8.48e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   117 EAEANRVSLAEIART-MQDMAGGADEEAGAT---QRVAENVEALTALA-------KDIAHLSSEGVNLVGEAKRREEKGR 185
Cdd:pfam05483 353 EFEATTCSLEELLRTeQQRLEKNEDQLKIITmelQKKSSELEEMTKFKnnkevelEELKKILAEDEKLLDEKKQFEKIAE 432
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   186 EV------LKVLLANMER----------AAVSIEEAAEKVMRlEVKIEKVNEFVRYvTEITDQTNLLALNAAIEAARAGD 249
Cdd:pfam05483 433 ELkgkeqeLIFLLQAREKeihdleiqltAIKTSEEHYLKEVE-DLKTELEKEKLKN-IELTAHCDKLLLENKELTQEASD 510
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   250 SGRGFAVVAGEV---RKLAERSAQAAQNI----VRIAETIQEVAKEAAKQVEEnvrlVKDNLEQGEETMREMEEVTEAFT 322
Cdd:pfam05483 511 MTLELKKHQEDIincKKQEERMLKQIENLeekeMNLRDELESVREEFIQKGDE----VKCKLDKSEENARSIEYEVLKKE 586
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   323 RVAGAMEEIYSNARKQAE-RAQNINQDASHMAAVAQETAAGVEEVTAsvahQEMAMETMEesvVKLSDMAGRFDELANQY 401
Cdd:pfam05483 587 KQMKILENKCNNLKKQIEnKNKNIEELHQENKALKKKGSAENKQLNA----YEIKVNKLE---LELASAKQKFEEIIDNY 659
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*.
gi 83589252   402 TKEGWDeatknsliqngmqilKSLAENSEIKsmQIEKLRKPFDEAV 447
Cdd:pfam05483 660 QKEIED---------------KKISEEKLLE--EVEKAKAIADEAV 688
MAD pfam05557
Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint ...
95-441 1.07e-03

Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins. The mitotic spindle checkpoint monitors proper attachment of the bipolar spindle to the kinetochores of aligned sister chromatids and causes a cell cycle arrest in prometaphase when failures occur. Multiple components of the mitotic spindle checkpoint have been identified in yeast and higher eukaryotes. In S.cerevisiae, the existence of a Mad1-dependent complex containing Mad2, Mad3, Bub3 and Cdc20 has been demonstrated.


Pssm-ID: 253253 [Multi-domain]  Cd Length: 722  Bit Score: 40.30  E-value: 1.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    95 RMIGNMQRSSDELNYLVGVIQREAEAN---RVSLAEIARTMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSSEGV 171
Cdd:pfam05557 175 EMQCRAQNADTELKLLESELEELREQLeecQKELAEAEKKLQSLTSEQASSADNSVKIKHLEEELKRYEQDAEVVKSMKE 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   172 NLVGEAKRREEKGR---------------EVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVnefvryVTEITDQTNLL 236
Cdd:pfam05557 255 QLLQIPELERELAAlreenrklrsmkednELLKEELEDLQSRLERFEKMREKLADLELEKEKL------ENELKSWKSLL 328
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   237 AlNAAIEAARAGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVeENVRLVKDNLEQGEETMREMEE 316
Cdd:pfam05557 329 Q-DIGLNLRTPDDLSRRIVVLQNEELQLKEKNGSISSSAKQLETTLQQLQLERQKAV-SEILELKKKLEALKALVRRLQR 406
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   317 VTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMaavaQETAAGVEEVTASVAHQEMAMETMEESVVKLSDMAGRFDE 396
Cdd:pfam05557 407 RLTLVTKERDGLRAILNSYDKELTETSVSGQLMKRL----EEAEDLVQKVQSHLAKMENQLSELEEDVGQQKDRNNTLET 482
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*
gi 83589252   397 LANQYTKEGWDEATKNSLIQNGMQILKSLAENSEiksMQIEKLRK 441
Cdd:pfam05557 483 EIKLLKEQLVSNERLLSFVKEATNALRLKIETLE---RERDRLRQ 524
PRK02224 PRK02224
chromosome segregation protein; Provisional
115-399 1.19e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.41  E-value: 1.19e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  115 QREAEANRVS-----LAEIARTMQDMAGGADEEAGATQRVAENVEALTA-----------LAKDIAHLSSEGVNLVGEAK 178
Cdd:PRK02224 273 EREELAEEVRdlrerLEELEEERDDLLAEAGLDDADAEAVEARREELEDrdeelrdrleeCRVAAQAHNEEAESLREDAD 352
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  179 RREEKG---REVLKVLLANMERAAVSIEEAAEKVMRLEVKIEKVNEfvRYVTEITDQTNLLALNAAIEAARAGDSGRgFA 255
Cdd:PRK02224 353 DLEERAeelREEAAELESELEEAREAVEDRREEIEELEEEIEELRE--RFGDAPVDLGNAEDFLEELREERDELRER-EA 429
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  256 VVAGEVRKLAERSAQAAQ------------------NIVRIAETIQEVAKEAAK--QVEENVRLVKDNLEQGE---ETMR 312
Cdd:PRK02224 430 ELEATLRTARERVEEAEAlleagkcpecgqpvegspHVETIEEDRERVEELEAEleDLEEEVEEVEERLERAEdlvEAED 509
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  313 EMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAA-------GVEEVTASVAHQEMAMETMEESVV 385
Cdd:PRK02224 510 RIERLEERREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREaaaeaeeEAEEAREEVAELNSKLAELKERIE 589
                        330
                 ....*....|....
gi 83589252  386 KLSDMAGRFDELAN 399
Cdd:PRK02224 590 SLERIRTLLAAIAD 603
AAA_27 pfam13514
AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain ...
131-347 2.41e-03

AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain contains a P-loop motif.


Pssm-ID: 257834 [Multi-domain]  Cd Length: 1112  Bit Score: 39.40  E-value: 2.41e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    131 TMQDMAGGADEEAGATQRVAENVEALTALAKDIAHLSsEGVNLVGEAKRREEKGREVLKVLLANMERAAVsIEEAAEKVM 210
Cdd:pfam13514  735 LLQNIKEKLQAADDLRQRIAQMERDLARFAEEVEALA-KALAPEMLATPADELARALKARLKRARDTAAE-ADRLAEEIE 812
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    211 RLEVKIEKVNEFVRY----VTEITDQTNLLALNAAIEAARAGDsgrgfavvagEVRKLAERSAQAAQNIVRI------AE 280
Cdd:pfam13514  813 EAEKQVSTAAAALDElearLTALLRAARVTTIEELLAAVERSD----------TYRELRRRLAALERTLERIcgglslEA 882
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 83589252    281 TIQEVAKEAAKQVEENVRLVKDNLEQGEETMREM-EEVTEAFTRVAgAMEEIYSNARKQAERAQNINQ 347
Cdd:pfam13514  883 LAAEKAALDPAELPARLELLARDIEELEEELNELaEQVVRAKQELA-RMDGGSTAAELAAERETLLAQ 949
PRK02224 PRK02224
chromosome segregation protein; Provisional
185-398 2.90e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 38.87  E-value: 2.90e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  185 REVLKVLLANMERAAVSIEEAAEkvmRLEVKIEKVNEFVRYVTEITDqtnllaLNAAIEAARagdsgRGFAVVAGEVRKL 264
Cdd:PRK02224 219 DEEIERYEEQREQARETRDEADE---VLEEHEERREELETLEAEIED------LRETIAETE-----REREELAEEVRDL 284
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252  265 AERSAQAAQnivRIAETIQEVAKEAAKQveENVRLVKDNLEQGEETMRE-MEEVTEAFTRVAGAMEEIYSNARKQAERAQ 343
Cdd:PRK02224 285 RERLEELEE---ERDDLLAEAGLDDADA--EAVEARREELEDRDEELRDrLEECRVAAQAHNEEAESLREDADDLEERAE 359
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 83589252  344 NINQDASHMAAVAQETAAGVEEVTASVAHQEMAMETMEESV----VKLSDMAGRFDELA 398
Cdd:PRK02224 360 ELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFgdapVDLGNAEDFLEELR 418
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
278-400 3.00e-03

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 38.04  E-value: 3.00e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    278 IAETIQEVAKEAAKQVEENvrlvkdnleqgEETMREMEEVTEAFTRVAGAMEEIYSNARKQAERAQNINQDashMAAVAQ 357
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEEL-----------EELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREA---VEDAIT 67
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|...
gi 83589252    358 ETAAGVEEVTASVAhqemAMETMEESVVKLSDMAGRFDELANQ 400
Cdd:smart00283  68 AMDQIREVVEEAVS----AVEELEESSDEIGEIVSVIDDIADQ 106
EspB pfam05802
Enterobacterial EspB protein; EspB is a type-III-secreted pore-forming protein of ...
254-371 4.88e-03

Enterobacterial EspB protein; EspB is a type-III-secreted pore-forming protein of enteropathogenic Escherichia coli (EPEC) which is essential for EPEC pathogenesis. EspB is also found in Citrobacter rodentium.


Pssm-ID: 114524 [Multi-domain]  Cd Length: 317  Bit Score: 37.74  E-value: 4.88e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   254 FAVVAGEVRKLAERSAQAAQNIVRIAETIQEVAKEAAKQVEENVrlvKDNLEQGEETMRE-MEEVTEAFTRVAGAMEEIY 332
Cdd:pfam05802 116 FAAINSATKGASDIAQKATSASSKAVNAASEVATKALVKATESV---ADAAEEASSTMQQaMATATKAASRTSGVADDVA 192
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 83589252   333 SNARKQAERAQNInQDASHMAAVAQETAAGVEEVTASVA 371
Cdd:pfam05802 193 TSAQKASQVAEEA-ADAAQKASRLSRFTAAVDKITGSTA 230
mukB PRK04863
cell division protein MukB; Provisional
114-347 4.98e-03

cell division protein MukB; Provisional


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 38.40  E-value: 4.98e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   114 IQREAEANRVSLAEIARTMQDMAggadeeagatQRVAENVEALTALAKDIaHLSSEGVNLVGEAKRREEKG---REVLKV 190
Cdd:PRK04863  291 LRRELYTSRRQLAAEQYRLVEMA----------RELAELNEAESDLEQDY-QAASDHLNLVQTALRQQEKIeryQADLEE 359
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   191 LLANMERAAVSIEEAAEKVMRLEVKIEKVNEFV-RYVTEITD--------QTNLLALNAAIEAARagdsgrgfavvagEV 261
Cdd:PRK04863  360 LEERLEEQNEVVEEADEQQEENEARAEAAEEEVdELKSQLADyqqaldvqQTRAIQYQQAVQALE-------------RA 426
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   262 RKLAERSAQAAQNivriAETIQEVAKEAAKQVEENVRLVKDNLEQGEETMREMEEVTEAFTRVAGAME------------ 329
Cdd:PRK04863  427 KQLCGLPDLTADN----AEDWLEEFQAKEQEATEELLSLEQKLSVAQAAHSQFEQAYQLVRKIAGEVSrseawdvarell 502
                         250
                  ....*....|....*...
gi 83589252   330 EIYSNARKQAERAQNINQ 347
Cdd:PRK04863  503 RRLREQRHLAEQLQQLRM 520
DNA_S_dndD TIGR03185
DNA sulfur modification protein DndD; This model describes the DndB protein encoded by an ...
141-387 6.17e-03

DNA sulfur modification protein DndD; This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria [DNA metabolism, Restriction/modification].


Pssm-ID: 234141 [Multi-domain]  Cd Length: 650  Bit Score: 37.74  E-value: 6.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   141 EEAGATQRVAENVEALTALAKDIAHLSSEGvNLVGEAK---RREEKGREVLKVLLANMERAAVSIEEAAEKVMRLEVKIE 217
Cdd:TIGR03185 270 QLKEIEAARKANRAQLRELAADPLPLLLIP-NLLDSTKaqlQKEEQSQQNQLTQEELEERDKELLESLPKLALPAEHVKE 348
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   218 KVNEFVRYVTEITDQTNLLALNAAIEAAR--------AGDSGRGFAVVAGEVRKLAERSAQAAQNIVRIA--ETIQEVAK 287
Cdd:TIGR03185 349 IAAELAEIDKPATTDSEIPHRLSGSELTQlevliqqvKRELQDAKSQLLKELRELEEELAEVDKKISTIPseEQIAQLLE 428
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252   288 EAAKQVEENVRL---VKDNLEQGEETMREMEEVteaftrvagameeiysnaRKQAERAQNINQDAshmaavaqetaagvE 364
Cdd:TIGR03185 429 ELGEAQNELFRSeaeIEELLRQLETLKEAIEAL------------------RKTLDEKTKQKINA--------------F 476
                         250       260
                  ....*....|....*....|...
gi 83589252   365 EVTASVAHQEMAMETMEESVVKL 387
Cdd:TIGR03185 477 ELERAITIADKAKKTLKEFREKL 499
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
188-435 6.48e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.11  E-value: 6.48e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    188 LKVLLANMERAAVSIEEAAEKVMRLEVKI----EKVNEFVRYVTEITD-----QTNLLALNAAIEAaragdsgrgfavVA 258
Cdd:TIGR02168  234 LEELREELEELQEELKEAEEELEELTAELqeleEKLEELRLEVSELEEeieelQKELYALANEISR------------LE 301
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    259 GEVRKLAERSAQAAQNIVRIAETIQEVA-------------KEAAKQVEENVRLVKDNLEQGEETMREME----EVTEAF 321
Cdd:TIGR02168  302 QQKQILRERLANLERQLEELEAQLEELEskldelaeelaelEEKLEELKEELESLEAELEELEAELEELEsrleELEEQL 381
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83589252    322 TRVAGAMEEIYSNARKQAERAQNINQDASHMAAVAQETAAGVEEVTASVAHQEMA--METMEESVVKLSDMAGRFDELAN 399
Cdd:TIGR02168  382 ETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKelQAELEELEEELEELQEELERLEE 461
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 83589252    400 QYTKEGWDEATKNSLIQNGMQILKSLaeNSEIKSMQ 435
Cdd:TIGR02168  462 ALEELREELEEAEQALDAAERELAQL--QARLDSLE 495
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH