NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83575961|gb|ABC22512|]
View 

methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Rhodospirillum rubrum ATCC 11170]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
19-122 6.01e-14

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 68.04  E-value: 6.01e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  19 TSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERDsAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWL 98
Cdd:cd00130   1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWV 79
                        90       100
                ....*....|....*....|....
gi 83575961  99 EASYNPILGLGGKPTGVLKIATDI 122
Cdd:cd00130  80 LVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-244 2.31e-13

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


:

Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 66.50  E-value: 2.31e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 142 SQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERDsAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLE 221
Cdd:cd00130   2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                        90       100
                ....*....|....*....|...
gi 83575961 222 ASYNPILNLDGKPYKVVKFATDI 244
Cdd:cd00130  81 VSLTPIRDEGGEVIGLLGVVRDI 103
MCP_signal super family cl21547
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
262-472 5.31e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 129.66  E-value: 5.31e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 262 VKATVETVASSAGKMqntaqamaaaaEQTSQQSSIVSTAAEELgtsvseiarqIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:cd11386   3 LSASIEEVAASADQV-----------AETSQQAAELAEKGREA----------AEDAINQMNQIDESVDEAVSAVEELEE 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 342 AADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSRATASAIR 421
Cdd:cd11386  62 SSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAME 141
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83575961 422 ----QIGLVIAQVSEISAS---ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTEL 472
Cdd:cd11386 142 etseEVEEGVELVEETGRAfeeIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEI 199
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
262-493 2.78e-42

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 152.05  E-value: 2.78e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    262 VKATVETVASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAAEELGTSVSEIARQIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    342 A-------ADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSR 414
Cdd:smart00283  82 AveeleesSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    415 ATASAIR---------------------QIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELL 473
Cdd:smart00283 162 EAVAAMEessseveegvelveetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83575961    474 SVAQSMSHQADDLETRVDAF 493
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
22-250 1.15e-24

FOG: PAS/PAC domain [Signal transduction mechanisms]


:

Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 101.85  E-value: 1.15e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  22 ALIEFDLDGTILAANTNFLTVMGYRLDEVRGkkhsLFVEPAERDSAEYRAFWDQLRRG-TFLAREFKRVGKGGKEIWLEA 100
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLG----LLLALHPEDRDRLRELLRRLLAGeELLSEELRLVRKDGEERWVEL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 101 SYNPILGLGGKPTGVLKIATDITRKKAEAV----ELQEKVAAISRSQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKN 176
Cdd:COG2202  77 SAAPLRDGEGRVLGLLGLRDITERKRAEEAlresEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRG 156
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 83575961 177 HSLFIAPGERDsAEYRQFWDILRRGEFQARQF---MRIGKGGRVVWLEASYNPILNlDGKPYKVVKFATDISGRKEE 250
Cdd:COG2202 157 LSDLIHPEDEE-RRELELARALAEGRGGPLEIeyrVRRKDGERVRWILSRISPVRD-DGEIVGVVGIARDITERKQA 231
 
Name Accession Description Interval E-value
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
19-122 6.01e-14

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 68.04  E-value: 6.01e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  19 TSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERDsAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWL 98
Cdd:cd00130   1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWV 79
                        90       100
                ....*....|....*....|....
gi 83575961  99 EASYNPILGLGGKPTGVLKIATDI 122
Cdd:cd00130  80 LVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-244 2.31e-13

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 66.50  E-value: 2.31e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 142 SQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERDsAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLE 221
Cdd:cd00130   2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                        90       100
                ....*....|....*....|...
gi 83575961 222 ASYNPILNLDGKPYKVVKFATDI 244
Cdd:cd00130  81 VSLTPIRDEGGEVIGLLGVVRDI 103
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
262-472 5.31e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 129.66  E-value: 5.31e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 262 VKATVETVASSAGKMqntaqamaaaaEQTSQQSSIVSTAAEELgtsvseiarqIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:cd11386   3 LSASIEEVAASADQV-----------AETSQQAAELAEKGREA----------AEDAINQMNQIDESVDEAVSAVEELEE 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 342 AADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSRATASAIR 421
Cdd:cd11386  62 SSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAME 141
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83575961 422 ----QIGLVIAQVSEISAS---ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTEL 472
Cdd:cd11386 142 etseEVEEGVELVEETGRAfeeIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEI 199
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
12-65 2.46e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 39.30  E-value: 2.46e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 83575961     12 NRLTALSTSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERD 65
Cdd:smart00091   3 LRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRE 56
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-187 1.15e-03

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 37.38  E-value: 1.15e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 83575961    142 SQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERD 187
Cdd:smart00091  11 PDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRE 56
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
262-493 2.78e-42

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 152.05  E-value: 2.78e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    262 VKATVETVASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAAEELGTSVSEIARQIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    342 A-------ADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSR 414
Cdd:smart00283  82 AveeleesSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    415 ATASAIR---------------------QIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELL 473
Cdd:smart00283 162 EAVAAMEessseveegvelveetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83575961    474 SVAQSMSHQADDLETRVDAF 493
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
22-250 1.15e-24

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 101.85  E-value: 1.15e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  22 ALIEFDLDGTILAANTNFLTVMGYRLDEVRGkkhsLFVEPAERDSAEYRAFWDQLRRG-TFLAREFKRVGKGGKEIWLEA 100
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLG----LLLALHPEDRDRLRELLRRLLAGeELLSEELRLVRKDGEERWVEL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 101 SYNPILGLGGKPTGVLKIATDITRKKAEAV----ELQEKVAAISRSQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKN 176
Cdd:COG2202  77 SAAPLRDGEGRVLGLLGLRDITERKRAEEAlresEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRG 156
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 83575961 177 HSLFIAPGERDsAEYRQFWDILRRGEFQARQF---MRIGKGGRVVWLEASYNPILNlDGKPYKVVKFATDISGRKEE 250
Cdd:COG2202 157 LSDLIHPEDEE-RRELELARALAEGRGGPLEIeyrVRRKDGERVRWILSRISPVRD-DGEIVGVVGIARDITERKQA 231
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
237-493 1.02e-36

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 139.74  E-value: 1.02e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 237 VVKFATDISGRKEENAALAKQFETGVK---ATVETVASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAAEELGTSVSEIAR 313
Cdd:COG0840 136 VQDNAEALSGASEEIAASATELSARADqqaESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVE 215
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 314 QIAQATrvtddavaetKASEKLVGELVTAADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLAN 393
Cdd:COG0840 216 QMQEIA----------EELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAE 285
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 394 QTAKATEEIEQQVSGIQDSS---------------------RATASAIRQIGLVIAQVSEISASISGAAEEQAAATREVS 452
Cdd:COG0840 286 RSADSAKEIGLLIEEIQNEAadavehmeesasevsegvklvEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEIN 365
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 83575961 453 QNINGVEQAAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:COG0840 366 ASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
298-493 2.46e-29

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 114.08  E-value: 2.46e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   298 STAAEELGTSVSEIARQIAQATRVTDDAVaetkaseKLVGELVTAADKIGAVSQLIADIASQTNLLALNATIEAARAGDA 377
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDAV-------ETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQ 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   378 GKGFAVVASEVKSLANQTAKATEEIEQQVSGIQ---------------------DSSRATASAIRQIGLVIAQVSEISAS 436
Cdd:pfam00015  74 GRGFAVVADEVRKLAERSAQAAKEIEALIEEIVkqtndstasiqqtrtevevgsTIVESTGEALKEIVDAVAEIADIVQE 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 83575961   437 ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:pfam00015 154 IAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
244-493 2.11e-27

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 114.01  E-value: 2.11e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  244 ISGRKEENAALA--KQFETGVKATVETVASSAGKMQNTAQAMAAAAEQTS-----QQSSIVSTAA--EELGTSVSEIARQ 314
Cdd:PRK09793 239 VYGRNEITAIFAslKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSsrteqQAASLAQTAAsmEQLTATVGQNADN 318
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  315 IAQATRVTDDAVAETKASEKLVGELVTAADKIGAVSQLIADIAS-------QTNLLALNATIEAARAGDAGKGFAVVASE 387
Cdd:PRK09793 319 ARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISvidgiafQTNILALNAAVEAARAGEQGRGFAVVAGE 398
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  388 VKSLANQTAKATEE----IEQQVSGIQDSSRATASAIR---QIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQ 460
Cdd:PRK09793 399 VRNLASRSAQAAKEikglIEESVNRVQQGSKLVNNAAAtmtDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQ 478
                        250       260       270
                 ....*....|....*....|....*....|...
gi 83575961  461 AAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:PRK09793 479 VTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
PAS_9 pfam13426
PAS domain;
20-123 2.17e-17

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 77.81  E-value: 2.17e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    20 SMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAErDSAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWLE 99
Cdd:pfam13426   1 PDGILVLDPEGRIVYANPAALRLLGYTREELLGKSIRDLFGPGT-DEEAVARLREALRNGGEVEVELELRRKDGEPFPVL 79
                          90       100
                  ....*....|....*....|....
gi 83575961   100 ASYNPILGLGGKPTGVLKIATDIT 123
Cdd:pfam13426  80 VSASPVRDEDGEVVGIVGILRDIT 103
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
22-129 3.57e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 66.15  E-value: 3.57e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    22 ALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVepAERDSAEYRAFWDQLRRG----TFLAREFKRvgKGGKEIW 97
Cdd:TIGR00229  15 AIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELI--PEEDREEVRERIERRLEGerepVSEERRVRR--KDGSEIW 90
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83575961    98 LEASYNPILGLGGKPtGVLKIATDIT-RKKAEA 129
Cdd:TIGR00229  91 VEVSVSPIRTNGGEL-GVVGIVRDITeRKQAEE 122
PRK13560 PRK13560
hypothetical protein; Provisional
118-248 2.55e-05

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 45.43  E-value: 2.55e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  118 IATDITRKKAEAVELQEkvaAISRSQAVIE--------FAMDGTILTANENFLKTMGYRLEDIQGKN-HSLfiAPGERDS 188
Cdd:PRK13560 185 FAEDITERKRAEERIDE---ALHFLQQLLDniadpafwKDEDAKVFGCNDAACLACGFRREEIIGMSiHDF--APAQPAD 259
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83575961  189 AEYRQFWDILRRGEFQARQFMRIGKGGRVVWLEASYNPIlNLDGKPYKV---VKFATDISGRK 248
Cdd:PRK13560 260 DYQEADAAKFDADGSQIIEAEFQNKDGRTRPVDVIFNHA-EFDDKENHCaglVGAITDISGRR 321
 
Name Accession Description Interval E-value
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
19-122 6.01e-14

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 68.04  E-value: 6.01e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  19 TSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERDsAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWL 98
Cdd:cd00130   1 LPDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWV 79
                        90       100
                ....*....|....*....|....
gi 83575961  99 EASYNPILGLGGKPTGVLKIATDI 122
Cdd:cd00130  80 LVSLTPIRDEGGEVIGLLGVVRDI 103
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-244 2.31e-13

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 66.50  E-value: 2.31e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 142 SQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERDsAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLE 221
Cdd:cd00130   2 PDGVIVLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDRE-ELRERLENLLSGGEPVTLEVRLRRKDGSVIWVL 80
                        90       100
                ....*....|....*....|...
gi 83575961 222 ASYNPILNLDGKPYKVVKFATDI 244
Cdd:cd00130  81 VSLTPIRDEGGEVIGLLGVVRDI 103
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
262-472 5.31e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 129.66  E-value: 5.31e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 262 VKATVETVASSAGKMqntaqamaaaaEQTSQQSSIVSTAAEELgtsvseiarqIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:cd11386   3 LSASIEEVAASADQV-----------AETSQQAAELAEKGREA----------AEDAINQMNQIDESVDEAVSAVEELEE 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 342 AADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSRATASAIR 421
Cdd:cd11386  62 SSAEIGEIVEVIDDIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAME 141
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83575961 422 ----QIGLVIAQVSEISAS---ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTEL 472
Cdd:cd11386 142 etseEVEEGVELVEETGRAfeeIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEI 199
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
12-65 2.46e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 39.30  E-value: 2.46e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 83575961     12 NRLTALSTSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERD 65
Cdd:smart00091   3 LRAILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRE 56
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
85-123 4.37e-04

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 38.32  E-value: 4.37e-04
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 83575961     85 EFKRVGKGGKEIWLEASYNPILGLGGKPTGVLKIATDIT 123
Cdd:smart00086   3 EYRLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDIT 41
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
142-187 1.15e-03

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 37.38  E-value: 1.15e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 83575961    142 SQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERD 187
Cdd:smart00091  11 PDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLELIHPEDRE 56
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
213-247 1.45e-03

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 36.78  E-value: 1.45e-03
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 83575961    213 KGGRVVWLEASYNPILNLDGKPYKVVKFATDISGR 247
Cdd:smart00086   9 KDGSYIWVLVSASPIRDEDGEVEGILGVVRDITER 43
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
262-493 2.78e-42

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 152.05  E-value: 2.78e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    262 VKATVETVASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAAEELGTSVSEIARQIAQATRVTDDAVAETKASEKLVGELVT 341
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    342 A-------ADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEEIEQQVSGIQDSSR 414
Cdd:smart00283  82 AveeleesSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    415 ATASAIR---------------------QIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELL 473
Cdd:smart00283 162 EAVAAMEessseveegvelveetgdaleEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEIS 241
                          250       260
                   ....*....|....*....|
gi 83575961    474 SVAQSMSHQADDLETRVDAF 493
Cdd:smart00283 242 AAAEELSGLAEELDELVERF 261
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
22-250 1.15e-24

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 101.85  E-value: 1.15e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  22 ALIEFDLDGTILAANTNFLTVMGYRLDEVRGkkhsLFVEPAERDSAEYRAFWDQLRRG-TFLAREFKRVGKGGKEIWLEA 100
Cdd:COG2202   1 LILVLDRDGRIIYANEAAEELLGYSAEELLG----LLLALHPEDRDRLRELLRRLLAGeELLSEELRLVRKDGEERWVEL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 101 SYNPILGLGGKPTGVLKIATDITRKKAEAV----ELQEKVAAISRSQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKN 176
Cdd:COG2202  77 SAAPLRDGEGRVLGLLGLRDITERKRAEEAlresEERLRALLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRG 156
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 83575961 177 HSLFIAPGERDsAEYRQFWDILRRGEFQARQF---MRIGKGGRVVWLEASYNPILNlDGKPYKVVKFATDISGRKEE 250
Cdd:COG2202 157 LSDLIHPEDEE-RRELELARALAEGRGGPLEIeyrVRRKDGERVRWILSRISPVRD-DGEIVGVVGIARDITERKQA 231
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
237-493 1.02e-36

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 139.74  E-value: 1.02e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 237 VVKFATDISGRKEENAALAKQFETGVK---ATVETVASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAAEELGTSVSEIAR 313
Cdd:COG0840 136 VQDNAEALSGASEEIAASATELSARADqqaESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVE 215
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 314 QIAQATrvtddavaetKASEKLVGELVTAADKIGAVSQLIADIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLAN 393
Cdd:COG0840 216 QMQEIA----------EELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAE 285
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 394 QTAKATEEIEQQVSGIQDSS---------------------RATASAIRQIGLVIAQVSEISASISGAAEEQAAATREVS 452
Cdd:COG0840 286 RSADSAKEIGLLIEEIQNEAadavehmeesasevsegvklvEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEIN 365
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 83575961 453 QNINGVEQAAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:COG0840 366 ASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
298-493 2.46e-29

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 114.08  E-value: 2.46e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   298 STAAEELGTSVSEIARQIAQATRVTDDAVaetkaseKLVGELVTAADKIGAVSQLIADIASQTNLLALNATIEAARAGDA 377
Cdd:pfam00015   1 AQASDLAQLASEEALDEMSQIGQVVDDAV-------ETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQ 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   378 GKGFAVVASEVKSLANQTAKATEEIEQQVSGIQ---------------------DSSRATASAIRQIGLVIAQVSEISAS 436
Cdd:pfam00015  74 GRGFAVVADEVRKLAERSAQAAKEIEALIEEIVkqtndstasiqqtrtevevgsTIVESTGEALKEIVDAVAEIADIVQE 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 83575961   437 ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:pfam00015 154 IAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
244-493 2.11e-27

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 114.01  E-value: 2.11e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  244 ISGRKEENAALA--KQFETGVKATVETVASSAGKMQNTAQAMAAAAEQTS-----QQSSIVSTAA--EELGTSVSEIARQ 314
Cdd:PRK09793 239 VYGRNEITAIFAslKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSsrteqQAASLAQTAAsmEQLTATVGQNADN 318
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  315 IAQATRVTDDAVAETKASEKLVGELVTAADKIGAVSQLIADIAS-------QTNLLALNATIEAARAGDAGKGFAVVASE 387
Cdd:PRK09793 319 ARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISvidgiafQTNILALNAAVEAARAGEQGRGFAVVAGE 398
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  388 VKSLANQTAKATEE----IEQQVSGIQDSSRATASAIR---QIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQ 460
Cdd:PRK09793 399 VRNLASRSAQAAKEikglIEESVNRVQQGSKLVNNAAAtmtDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQ 478
                        250       260       270
                 ....*....|....*....|....*....|...
gi 83575961  461 AAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:PRK09793 479 VTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
244-493 5.72e-23

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 100.85  E-value: 5.72e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  244 ISGRKE--ENAALAKQFETGVKATVETV-----ASSAGKMQNTAQAMAAAAEQTSQQSSIVSTAA--EELGTSVSEIARQ 314
Cdd:PRK15048 241 IDGRSEmgDLAQSVSHMQRSLTDTVTHVregsdAIYAGTREIAAGNTDLSSRTEQQASALEETAAsmEQLTATVKQNADN 320
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  315 IAQATRVTDDAVAETKASEKLVGELVTAADKIGAVSQLIADIAS-------QTNLLALNATIEAARAGDAGKGFAVVASE 387
Cdd:PRK15048 321 ARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISvidgiafQTNILALNAAVEAARAGEQGRGFAVVAGE 400
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  388 VKSLANQTAKATEE----IEQQVSGIQDSSRATASA---IRQIGLVIAQVSEISASISGAAEEQAAATREVSQNINGVEQ 460
Cdd:PRK15048 401 VRNLASRSAQAAKEikalIEDSVSRVDTGSVLVESAgetMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDR 480
                        250       260       270
                 ....*....|....*....|....*....|...
gi 83575961  461 AAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:PRK15048 481 VTQQNASLVQESAAAAAALEEQASRLTQAVSAF 513
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
289-493 1.58e-21

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 96.56  E-value: 1.58e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  289 QTSQQS-SIVSTAA--EELGTSVSEIARQIAQATRVTDDAVAETKASEKLVGELVTAADKIGAVSQLIADIAS------- 358
Cdd:PRK15041 294 RTEQQAaSLEETAAsmEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISvidgiaf 373
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  359 QTNLLALNATIEAARAGDAGKGFAVVASEVKSLANQTAKATEE----IEQQVSGIQDSSRATASA---IRQIGLVIAQVS 431
Cdd:PRK15041 374 QTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREikslIEDSVGKVDVGSTLVESAgetMAEIVSAVTRVT 453
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 83575961  432 EISASISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELLSVAQSMSHQADDLETRVDAF 493
Cdd:PRK15041 454 DIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVF 515
PAS_9 pfam13426
PAS domain;
20-123 2.17e-17

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 77.81  E-value: 2.17e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    20 SMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAErDSAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWLE 99
Cdd:pfam13426   1 PDGILVLDPEGRIVYANPAALRLLGYTREELLGKSIRDLFGPGT-DEEAVARLREALRNGGEVEVELELRRKDGEPFPVL 79
                          90       100
                  ....*....|....*....|....
gi 83575961   100 ASYNPILGLGGKPTGVLKIATDIT 123
Cdd:pfam13426  80 VSASPVRDEDGEVVGIVGILRDIT 103
PAS_9 pfam13426
PAS domain;
144-245 1.28e-16

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 75.88  E-value: 1.28e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   144 AVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGErDSAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLEAS 223
Cdd:pfam13426   3 GILVLDPEGRIVYANPAALRLLGYTREELLGKSIRDLFGPGT-DEEAVARLREALRNGGEVEVELELRRKDGEPFPVLVS 81
                          90       100
                  ....*....|....*....|..
gi 83575961   224 YNPILNLDGKPYKVVKFATDIS 245
Cdd:pfam13426  82 ASPVRDEDGEVVGIVGILRDIT 103
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
22-129 3.57e-13

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 66.15  E-value: 3.57e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    22 ALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVepAERDSAEYRAFWDQLRRG----TFLAREFKRvgKGGKEIW 97
Cdd:TIGR00229  15 AIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELI--PEEDREEVRERIERRLEGerepVSEERRVRR--KDGSEIW 90
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83575961    98 LEASYNPILGLGGKPtGVLKIATDIT-RKKAEA 129
Cdd:TIGR00229  91 VEVSVSPIRTNGGEL-GVVGIVRDITeRKQAEE 122
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
18-127 1.65e-12

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 63.97  E-value: 1.65e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    18 STSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKK-HSLFVEPaerDSAEYRAFWDQLRRGTFLAREFKRVGKGGKEI 96
Cdd:pfam08448   3 SLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGKTlAELLPPE---DAARLERALRRALEGEEPIDFLEELLLNGEER 79
                          90       100       110
                  ....*....|....*....|....*....|.
gi 83575961    97 WLEASYNPILGLGGKPTGVLKIATDITRKKA 127
Cdd:pfam08448  80 HYELRLTPLRDPDGEVIGVLVISRDITERRR 110
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
154-241 2.18e-12

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 63.17  E-value: 2.18e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   154 ILTANENFLKTMGYRLEDIQGK----NHSLFIAPGERDSAEYRQFWdiLRRGEFQARQFMRIGKGGRVVWLEASYNPILN 229
Cdd:pfam08447   1 IIYWSPRFEEILGYTPEELKSSyegwLDLVHPEDRERVRRALQELL--LKKGEPYSGEYRIRRKDGSYRWVEARGRPIRD 78
                          90
                  ....*....|..
gi 83575961   230 LDGKPYKVVKFA 241
Cdd:pfam08447  79 ENGKPVRVIGVA 90
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
144-254 2.31e-11

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator [Regulatory functions, Small molecule interactions].


Pssm-ID: 232884 [Multi-domain]  Cd Length: 124  Bit Score: 61.14  E-value: 2.31e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   144 AVIEFAMDGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGERDSAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLEAS 223
Cdd:TIGR00229  15 AIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERRLEGEREPVSEERRVRRKDGSEIWVEVS 94
                          90       100       110
                  ....*....|....*....|....*....|.
gi 83575961   224 YNPILNLDGKPYkVVKFATDISGRKEENAAL 254
Cdd:TIGR00229  95 VSPIRTNGGELG-VVGIVRDITERKQAEEAL 124
PAS_3 pfam08447
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
32-119 9.27e-11

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254805 [Multi-domain]  Cd Length: 90  Bit Score: 58.55  E-value: 9.27e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    32 ILAANTNFLTVMGYRLDEVRGKK----HSLFVEPAERDSAEYRAFWdqLRRGTFLAREFKRVGKGGKEIWLEASYNPILG 107
Cdd:pfam08447   1 IIYWSPRFEEILGYTPEELKSSYegwlDLVHPEDRERVRRALQELL--LKKGEPYSGEYRIRRKDGSYRWVEARGRPIRD 78
                          90
                  ....*....|..
gi 83575961   108 LGGKPTGVLKIA 119
Cdd:pfam08447  79 ENGKPVRVIGVA 90
AtoS COG2202
FOG: PAS/PAC domain [Signal transduction mechanisms]
18-128 1.35e-09

FOG: PAS/PAC domain [Signal transduction mechanisms]


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 57.17  E-value: 1.35e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  18 STSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERDSAEYRAF-WDQLRRGTFLAREFKRVGKGGKEI 96
Cdd:COG2202 120 ASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLIHPEDEERRELELArALAEGRGGPLEIEYRVRRKDGERV 199
                        90       100       110
                ....*....|....*....|....*....|...
gi 83575961  97 WLEASYNPILGLGGKPTGVLKIATDIT-RKKAE 128
Cdd:COG2202 200 RWILSRISPVRDDGEIVGVVGIARDITeRKQAE 232
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
140-249 5.00e-09

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 53.96  E-value: 5.00e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   140 SRSQAVIEFAMDGTILTANENFLKTMGYRLEDIQGKnhSLFIAPGERDSAEYRQFWDILRRGEFQARQFMRIGKGGRVVW 219
Cdd:pfam08448   3 SLPDALAVLDPDGRVRYANAAAAELFGLPPEELLGK--TLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGEERH 80
                          90       100       110
                  ....*....|....*....|....*....|
gi 83575961   220 LEASYNPILNLDGKPYKVVKFATDISGRKE 249
Cdd:pfam08448  81 YELRLTPLRDPDGEVIGVLVISRDITERRR 110
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
151-244 2.93e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 45.47  E-value: 2.93e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   151 DGTILTANENFLKTMGYRLEDIQGKNHSLFIAPGerDSAEYRQFWDILR-RGEFQARQFMRIGKGGRVVWLEASYNPILN 229
Cdd:pfam00989  20 DGRILYVNAAAEELLGLSREEVIGKSLLDLIPEE--DDAVAELLRQALLqGEESRGFEVSFRVRDGRPRHVEVRASPVRD 97
                          90
                  ....*....|....*
gi 83575961   230 LDGKPYkVVKFATDI 244
Cdd:pfam00989  98 AGGEIG-FLGVLRDI 111
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
27-122 6.47e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 250275 [Multi-domain]  Cd Length: 111  Bit Score: 44.31  E-value: 6.47e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    27 DLDGTILAANTNFLTVMGYRLDEVRGKkhSLFVEPAERDSAEYRAFWDQLRRGT-FLAREFKRVGKGGKEIWLEASYNPI 105
Cdd:pfam00989  18 DEDGRILYVNAAAEELLGLSREEVIGK--SLLDLIPEEDDAVAELLRQALLQGEeSRGFEVSFRVRDGRPRHVEVRASPV 95
                          90
                  ....*....|....*..
gi 83575961   106 LGLGGKPtGVLKIATDI 122
Cdd:pfam00989  96 RDAGGEI-GFLGVLRDI 111
PRK13560 PRK13560
hypothetical protein; Provisional
118-248 2.55e-05

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 45.43  E-value: 2.55e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  118 IATDITRKKAEAVELQEkvaAISRSQAVIE--------FAMDGTILTANENFLKTMGYRLEDIQGKN-HSLfiAPGERDS 188
Cdd:PRK13560 185 FAEDITERKRAEERIDE---ALHFLQQLLDniadpafwKDEDAKVFGCNDAACLACGFRREEIIGMSiHDF--APAQPAD 259
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83575961  189 AEYRQFWDILRRGEFQARQFMRIGKGGRVVWLEASYNPIlNLDGKPYKV---VKFATDISGRK 248
Cdd:PRK13560 260 DYQEADAAKFDADGSQIIEAEFQNKDGRTRPVDVIFNHA-EFDDKENHCaglVGAITDISGRR 321
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
289-478 1.18e-04

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 43.06  E-value: 1.18e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 289 QTSQQSSIVSTAAEELGTSVSEIARQIAQATRVTDDAVAETKASEKLVGELVTAADKIGAVSQLIADIAS---------- 358
Cdd:COG0840   4 EAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVlvlailllra 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961 359 -QTNLLALNATIEAARAGDAGKGFAVVAS-EVKSLANQTAKATEEIEQQVSGIQDSSRATASAIRQIGLVIAQVSEISAS 436
Cdd:COG0840  84 iLEPISDLLEVVERIAAGDLTKRIDESSNdEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQ 163
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 83575961 437 ISGAAEEQAAATREVSQNINGVEQAAAQTGRSSTELLSVAQS 478
Cdd:COG0840 164 QAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEE 205
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
14-245 1.55e-04

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183097 [Multi-domain]  Cd Length: 799  Bit Score: 42.83  E-value: 1.55e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   14 LTALSTS-MALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAERDsaeyrAFWDQLR--------RGTFLAR 84
Cdd:PRK11359  15 FPALEQNmMGAVLINENDEVLFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRP-----AHPEYIRhnreggkaRVEGMSR 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   85 EFKRVGKGGKEIWLEASYNPIlGLGGKpTGVLKIATDITRKKAEAVELQEKVAAISRS-QAVIEFAMDGTILTANENFLK 163
Cdd:PRK11359  90 ELQLEKKDGSKIWTRFALSKV-SAEGK-VYYLALVRDASVEMAQKEQTRQLIIAVDHLdRPVIVLDPERRIVQCNRAFTE 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  164 TMGYRLEDIQGKNHSLFIAPGERDSAEYRQFWDILRRGEFQARQFMRIGKGGRVVWLEASYNPILN-LDGKPYKVVKFaT 242
Cdd:PRK11359 168 MFGYCISEASGMQPDTLLNIPEFPADNRIRLQQLLWKTARDQDEFLLLTRTGEKIWIKASISPVYDvLAHLQNLVMTF-S 246

                 ...
gi 83575961  243 DIS 245
Cdd:PRK11359 247 DIT 249
PRK11359 PRK11359
cyclic-di-GMP phosphodiesterase; Provisional
12-126 5.35e-04

cyclic-di-GMP phosphodiesterase; Provisional


Pssm-ID: 183097 [Multi-domain]  Cd Length: 799  Bit Score: 41.29  E-value: 5.35e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   12 NRLTALS---TSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVEPAErDSAEYRAFWDQLRRGT-FLAREFK 87
Cdd:PRK11359 135 TRQLIIAvdhLDRPVIVLDPERRIVQCNRAFTEMFGYCISEASGMQPDTLLNIPE-FPADNRIRLQQLLWKTaRDQDEFL 213
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 83575961   88 RVGKGGKEIWLEASYNPILGLGGKPTGVLKIATDITRKK 126
Cdd:PRK11359 214 LLTRTGEKIWIKASISPVYDVLAHLQNLVMTFSDITEER 252
PRK13560 PRK13560
hypothetical protein; Provisional
27-247 6.87e-04

hypothetical protein; Provisional


Pssm-ID: 106506 [Multi-domain]  Cd Length: 807  Bit Score: 40.81  E-value: 6.87e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   27 DLDGTILAANTNFLTVMGYRLDEVRGKK-HSLfvEPAERDSAEYRAFWDQLRRGTFLAREFKRVGKGGKEIWLEASYNPI 105
Cdd:PRK13560 221 DEDAKVFGCNDAACLACGFRREEIIGMSiHDF--APAQPADDYQEADAAKFDADGSQIIEAEFQNKDGRTRPVDVIFNHA 298
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  106 --LGLGGKPTGVLKIATDITRKKAEAVELQEKVaaiSRSQAVIEFA--------MDGTILTANENFLKTM-GYRLEDIQG 174
Cdd:PRK13560 299 efDDKENHCAGLVGAITDISGRRAAERELLEKE---DMLRAIIEAApiaaigldADGNICFVNNNAAERMlGWSAAEVMG 375
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961  175 KNhslfiAPG-------ERDSAEYRQFWDILRRGEFQARQFMRIGKGGRVvwLEASYNPILNLDGKPYKVVKFAT---DI 244
Cdd:PRK13560 376 KP-----LPGmdpelneEFWCGDFQEWYPDGRPMAFDACPMAKTIKGGKI--FDGQEVLIEREDDGPADCSAYAEplhDA 448

                 ...
gi 83575961  245 SGR 247
Cdd:PRK13560 449 DGN 451
PRK11360 PRK11360
sensory histidine kinase AtoS; Provisional
12-149 1.15e-03

sensory histidine kinase AtoS; Provisional


Pssm-ID: 236901 [Multi-domain]  Cd Length: 607  Bit Score: 39.95  E-value: 1.15e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961   12 NRLTALSTSMALIEFDLDGTILAANTNFLTVMGYRLDEVRGKK-HSLFVEPAerDSAEYraFWDQLRRGTFLAREFKRVG 90
Cdd:PRK11360 264 NELILESIADGVIAIDRQGKITTMNPAAEVITGLQRHELVGKPySELFPPNT--PFASP--LLDTLEHGTEHVDLEISFP 339
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 83575961   91 KGGKEIWLEASYNPILGLGGKPTGVLKIATDITrkkaEAVELQEKVAAISRSQAVIEFA 149
Cdd:PRK11360 340 GRDRTIELSVSTSLLHNTHGEMIGALVIFSDLT----ERKRLQRRVARQERLAALGELV 394
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
27-137 5.09e-03

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions].


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 37.96  E-value: 5.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83575961    27 DLDGTILAANTNFLTVMGYRLDEVRGKKHSLFVE---PAErdsaEYRAFWDQLRR-----GTFLAREfkrvgKGGKEIWL 98
Cdd:TIGR02938  21 DLKANILYANDAFTRITGYTKEEIIGKNESVLSNhttPPE----VYQALWGSLAEqkpwaGKLLNRR-----KDGELYLA 91
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 83575961    99 EASYNPILGLGGKPTGVLKIATDITrkkaEAVELQEKVA 137
Cdd:TIGR02938  92 ELTVAPVLNEAGETTHFLGMHRDIT----ELHRLEQVVA 126
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH