NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83312619|ref|YP_422883|]
View 

Serine phosphatase RsbU, regulator of sigma subunit [Magnetospirillum magneticum AMB-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
508-700 2.86e-51

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 178.64  E-value: 2.86e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   508 DHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDNPQTLFATCFYGVLDTRTGEVGFCNA 587
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   588 GHPPPMILRGDGRVDAIRDVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEAQDSVDALYDEPRLIAELGRTADTA 667
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|...
gi 83312619   668 PEAVIAAVLRSVEAFvGSAPQFDDITMLTLRFD 700
Cdd:pfam07228 161 PEELLDALLEDLLRL-GGGELEDDITLLVLRVR 192
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
768-895 8.26e-25

Histidine kinase-like ATPase domain;


:

Pssm-ID: 257897  Cd Length: 126  Bit Score: 101.55  E-value: 8.26e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   768 IANDVGELERLAELVDVFVEKHNLPEKLAFNLNVCLDELITNIISYGYDDEDSHEIQVEFVYDGREFVTTIIDDAKEYNP 847
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAYREDPGGPVRVRLEIDGDGLVVEVRDSGPGFDP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 83312619   848 FvEAPIPDLDlDVDDRPIGGLGVFLVKEFMDGTDYAHEGGRNTTTLRK 895
Cdd:pfam13581  81 L-ELPDPDLT-EPDDLPEGGRGLFLIRQLMDEVEYERGDGGNVLRLTK 126
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
408-701 1.91e-55

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


:

Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 196.08  E-value: 1.91e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 408 ELEVLAVAFQTMSSRIREQHERLESLIAERTRDVEILREALRT-RDQLAALRQELDFARELQLSSLPQVFPPFPDraeFQ 486
Cdd:COG2208  74 GVSGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELlLLEQNNISAELEVARQIQQNLLPKALPLFPG---ID 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 487 IHASMVPAKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVaPLSSS--PGECLAFVNTMLARDNPQ 564
Cdd:COG2208 151 IEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLL-LESGPldPADVLETLNRVLKQNLEE 229
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 565 TLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDGRVDAIR-DVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEA 643
Cdd:COG2208 230 DMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDlTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEA 309
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83312619 644 QDSVDALYDEPRLIAELGRTADTAPEAVIAAVLRSVEAFVGSAPQFDDITMLTLRFDL 701
Cdd:COG2208 310 RNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
508-700 2.86e-51

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 178.64  E-value: 2.86e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   508 DHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDNPQTLFATCFYGVLDTRTGEVGFCNA 587
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   588 GHPPPMILRGDGRVDAIRDVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEAQDSVDALYDEPRLIAELGRTADTA 667
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|...
gi 83312619   668 PEAVIAAVLRSVEAFvGSAPQFDDITMLTLRFD 700
Cdd:pfam07228 161 PEELLDALLEDLLRL-GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
483-681 1.25e-34

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 131.70  E-value: 1.25e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619    483 AEFQIHASMVPAKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDN 562
Cdd:smart00331   2 DGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619    563 PQTLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDGRVDAIRDVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTE 642
Cdd:smart00331  82 EDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE 161
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 83312619    643 AQdsvdalyDEPRLIAELGRTADTAPEAVIAAVLRSVEA 681
Cdd:smart00331 162 AR-------NPERLEELLEELLGSPPAEIAQRILEELLE 193
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
768-895 8.26e-25

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 101.55  E-value: 8.26e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   768 IANDVGELERLAELVDVFVEKHNLPEKLAFNLNVCLDELITNIISYGYDDEDSHEIQVEFVYDGREFVTTIIDDAKEYNP 847
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAYREDPGGPVRVRLEIDGDGLVVEVRDSGPGFDP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 83312619   848 FvEAPIPDLDlDVDDRPIGGLGVFLVKEFMDGTDYAHEGGRNTTTLRK 895
Cdd:pfam13581  81 L-ELPDPDLT-EPDDLPEGGRGLFLIRQLMDEVEYERGDGGNVLRLTK 126
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
778-897 4.85e-10

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 58.54  E-value: 4.85e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 778 LAELVDVFVEKHNLPEKLAFNLNVCLDELITNIISYGYDDEDSH-EIQVEFVYDGREFVTTIIDDAKEYNPfVEAPIPDL 856
Cdd:COG2172  20 ARLTLREFARELGLTYVDIADLAIAVSEALTNAVKHAYKLDPSEgEIRIEVSLDDGKLEIRIWDQGPGIED-LEESLGPG 98
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 83312619 857 DLDVDDRPIGGLGVFLVKEFMDGTDYA-HEGGRNTTTLRKTI 897
Cdd:COG2172  99 DTTAEGLQEGGLGLFLAKRLMDEFSYErSEDGRNRLTKITLR 140
rsbW_low_gc TIGR01924
serine-protein kinase RsbW; This model describes the anti-sigma B factor also known as ...
798-886 6.45e-06

serine-protein kinase RsbW; This model describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter. RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex. Low ATP level or environmental stress causes the dephosphorylation of RsbV..


Pssm-ID: 233640  Cd Length: 159  Bit Score: 45.94  E-value: 6.45e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   798 NLNVCLDELITNIISYGYDDEDSHEIQVEF-VYDGR-EFVTTIIDDAKEYNPFVEAPIP-DLDLDVDDRPIGGLGVFLVK 874
Cdd:TIGR01924  42 DLKIAVSEACTNAVKHAYKEGENGEIGISFhIYEDRlEIIVSDQGDSFDMDTFKQSLGPyDGSEPIDDLREGGLGLFLIE 121
                          90
                  ....*....|...
gi 83312619   875 EFMDGTD-YAHEG 886
Cdd:TIGR01924 122 TLMDEVEvYEDSG 134
PRK04069 PRK04069
serine-protein kinase RsbW; Provisional
805-896 9.80e-04

serine-protein kinase RsbW; Provisional


Pssm-ID: 235217  Cd Length: 161  Bit Score: 39.52  E-value: 9.80e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619  805 ELITNIISYGYDDEDSHEIQVEF-VYDGR-EFVttIIDDAK--EYNPFVE--APIpDLDLDVDDRPIGGLGVFLVKEFMD 878
Cdd:PRK04069  49 EACTNAVQHAYKEDEVGEIHIRFeIYEDRlEIV--VADNGVsfDYETLKSklGPY-DISKPIEDLREGGLGLFLIETLMD 125
                         90
                 ....*....|....*...
gi 83312619  879 GTDYAHEGGrntTTLRKT 896
Cdd:PRK04069 126 DVTVYKDSG---VTVSMT 140
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
408-701 1.91e-55

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 196.08  E-value: 1.91e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 408 ELEVLAVAFQTMSSRIREQHERLESLIAERTRDVEILREALRT-RDQLAALRQELDFARELQLSSLPQVFPPFPDraeFQ 486
Cdd:COG2208  74 GVSGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELlLLEQNNISAELEVARQIQQNLLPKALPLFPG---ID 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 487 IHASMVPAKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVaPLSSS--PGECLAFVNTMLARDNPQ 564
Cdd:COG2208 151 IEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLL-LESGPldPADVLETLNRVLKQNLEE 229
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 565 TLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDGRVDAIR-DVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEA 643
Cdd:COG2208 230 DMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDlTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEA 309
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83312619 644 QDSVDALYDEPRLIAELGRTADTAPEAVIAAVLRSVEAFVGSAPQFDDITMLTLRFDL 701
Cdd:COG2208 310 RNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
487-700 2.68e-10

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 62.79  E-value: 2.68e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   487 IHASMVP--AKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDNPQ 564
Cdd:TIGR02865 554 TGVARAAkdGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSILSLRSTD 633
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   565 TLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDgRVDAIRdVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEAQ 644
Cdd:TIGR02865 634 EKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGA-KVEVIR-SSNLPIGILDEVDVELVRKKLKNGDLIVMVSDGVLEGE 711
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 83312619   645 DSVDAlyDEPRLIAELGRTADTAPEAVIAAVLRSVEAFVGSAPQfDDITMLTLRFD 700
Cdd:TIGR02865 712 KEVEG--KVLWLVRKLKETNTNDPEEIAEYLLEKAKELRSGKIK-DDMTVIVAKVY 764
ERM pfam00769
Ezrin/radixin/moesin family; This family of proteins contain a band 4.1 domain (pfam00373), at ...
363-466 9.58e-05

Ezrin/radixin/moesin family; This family of proteins contain a band 4.1 domain (pfam00373), at their amino terminus. This family represents the rest of these proteins.


Pssm-ID: 250119 [Multi-domain]  Cd Length: 244  Bit Score: 43.59  E-value: 9.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   363 RLQMLRLSEMLEQDAREAvLGDLKQIEELSNRSTSGDQGGDGAKGELEVLAVAFQTMSSRIREQ-------HERLESLIA 435
Cdd:pfam00769   7 LQELEERLEQMEEDMRMA-QKALEEYERKALELEEKLQQEEEEAELLEKKADELEEMNRRLEEEamaqeeeKERLEAERD 85
                          90       100       110
                  ....*....|....*....|....*....|..
gi 83312619   436 ERTRDVEILREALRTRDQLAA-LRQELDFARE 466
Cdd:pfam00769  86 EATAEVAKLEVAREKKEAEKEqLQQELREARE 117
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
508-700 2.86e-51

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 178.64  E-value: 2.86e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   508 DHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDNPQTLFATCFYGVLDTRTGEVGFCNA 587
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   588 GHPPPMILRGDGRVDAIRDVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEAQDSVDALYDEPRLIAELGRTADTA 667
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGELFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|...
gi 83312619   668 PEAVIAAVLRSVEAFvGSAPQFDDITMLTLRFD 700
Cdd:pfam07228 161 PEELLDALLEDLLRL-GGGELEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
483-681 1.25e-34

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 131.70  E-value: 1.25e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619    483 AEFQIHASMVPAKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDN 562
Cdd:smart00331   2 DGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619    563 PQTLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDGRVDAIRDVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTE 642
Cdd:smart00331  82 EDGMFATLFLALYDFAGGTLSYANAGHSPPYLLRADGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE 161
                          170       180       190
                   ....*....|....*....|....*....|....*....
gi 83312619    643 AQdsvdalyDEPRLIAELGRTADTAPEAVIAAVLRSVEA 681
Cdd:smart00331 162 AR-------NPERLEELLEELLGSPPAEIAQRILEELLE 193
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
768-895 8.26e-25

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 101.55  E-value: 8.26e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   768 IANDVGELERLAELVDVFVEKHNLPEKLAFNLNVCLDELITNIISYGYDDEDSHEIQVEFVYDGREFVTTIIDDAKEYNP 847
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAYREDPGGPVRVRLEIDGDGLVVEVRDSGPGFDP 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 83312619   848 FvEAPIPDLDlDVDDRPIGGLGVFLVKEFMDGTDYAHEGGRNTTTLRK 895
Cdd:pfam13581  81 L-ELPDPDLT-EPDDLPEGGRGLFLIRQLMDEVEYERGDGGNVLRLTK 126
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
778-897 4.85e-10

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 58.54  E-value: 4.85e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 778 LAELVDVFVEKHNLPEKLAFNLNVCLDELITNIISYGYDDEDSH-EIQVEFVYDGREFVTTIIDDAKEYNPfVEAPIPDL 856
Cdd:COG2172  20 ARLTLREFARELGLTYVDIADLAIAVSEALTNAVKHAYKLDPSEgEIRIEVSLDDGKLEIRIWDQGPGIED-LEESLGPG 98
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 83312619 857 DLDVDDRPIGGLGVFLVKEFMDGTDYA-HEGGRNTTTLRKTI 897
Cdd:COG2172  99 DTTAEGLQEGGLGLFLAKRLMDEFSYErSEDGRNRLTKITLR 140
rsbW_low_gc TIGR01924
serine-protein kinase RsbW; This model describes the anti-sigma B factor also known as ...
798-886 6.45e-06

serine-protein kinase RsbW; This model describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter. RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex. Low ATP level or environmental stress causes the dephosphorylation of RsbV..


Pssm-ID: 233640  Cd Length: 159  Bit Score: 45.94  E-value: 6.45e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   798 NLNVCLDELITNIISYGYDDEDSHEIQVEF-VYDGR-EFVTTIIDDAKEYNPFVEAPIP-DLDLDVDDRPIGGLGVFLVK 874
Cdd:TIGR01924  42 DLKIAVSEACTNAVKHAYKEGENGEIGISFhIYEDRlEIIVSDQGDSFDMDTFKQSLGPyDGSEPIDDLREGGLGLFLIE 121
                          90
                  ....*....|...
gi 83312619   875 EFMDGTD-YAHEG 886
Cdd:TIGR01924 122 TLMDEVEvYEDSG 134
PRK04069 PRK04069
serine-protein kinase RsbW; Provisional
805-896 9.80e-04

serine-protein kinase RsbW; Provisional


Pssm-ID: 235217  Cd Length: 161  Bit Score: 39.52  E-value: 9.80e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619  805 ELITNIISYGYDDEDSHEIQVEF-VYDGR-EFVttIIDDAK--EYNPFVE--APIpDLDLDVDDRPIGGLGVFLVKEFMD 878
Cdd:PRK04069  49 EACTNAVQHAYKEDEVGEIHIRFeIYEDRlEIV--VADNGVsfDYETLKSklGPY-DISKPIEDLREGGLGLFLIETLMD 125
                         90
                 ....*....|....*...
gi 83312619  879 GTDYAHEGGrntTTLRKT 896
Cdd:PRK04069 126 DVTVYKDSG---VTVSMT 140
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
408-701 1.91e-55

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 196.08  E-value: 1.91e-55
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 408 ELEVLAVAFQTMSSRIREQHERLESLIAERTRDVEILREALRT-RDQLAALRQELDFARELQLSSLPQVFPPFPDraeFQ 486
Cdd:COG2208  74 GVSGKLRALSEEIKHWRGGLPLVAELLVEINRAVGLVSAHNELlLLEQNNISAELEVARQIQQNLLPKALPLFPG---ID 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 487 IHASMVPAKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVaPLSSS--PGECLAFVNTMLARDNPQ 564
Cdd:COG2208 151 IEAILVPASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLL-LESGPldPADVLETLNRVLKQNLEE 229
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619 565 TLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDGRVDAIR-DVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEA 643
Cdd:COG2208 230 DMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDlTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEA 309
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83312619 644 QDSVDALYDEPRLIAELGRTADTAPEAVIAAVLRSVEAFVGSAPQFDDITMLTLRFDL 701
Cdd:COG2208 310 RNSDGEFFGLERLLKILGRLLGQPAEEILEAILESLEELQGDQIQDDDITLLVLKVKK 367
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
487-700 2.68e-10

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 62.79  E-value: 2.68e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   487 IHASMVP--AKEVGGDFYDFFFIDHHNLGFVIGDASGKGVPAAMFIAITRSLVKAVAPLSSSPGECLAFVNTMLARDNPQ 564
Cdd:TIGR02865 554 TGVARAAkdGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSILSLRSTD 633
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   565 TLFATCFYGVLDTRTGEVGFCNAGHPPPMILRGDgRVDAIRdVSGVALGVMEDLDYETGHFQLAPGEVVHLYTDGVTEAQ 644
Cdd:TIGR02865 634 EKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGA-KVEVIR-SSNLPIGILDEVDVELVRKKLKNGDLIVMVSDGVLEGE 711
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 83312619   645 DSVDAlyDEPRLIAELGRTADTAPEAVIAAVLRSVEAFVGSAPQfDDITMLTLRFD 700
Cdd:TIGR02865 712 KEVEG--KVLWLVRKLKETNTNDPEEIAEYLLEKAKELRSGKIK-DDMTVIVAKVY 764
ERM pfam00769
Ezrin/radixin/moesin family; This family of proteins contain a band 4.1 domain (pfam00373), at ...
363-466 9.58e-05

Ezrin/radixin/moesin family; This family of proteins contain a band 4.1 domain (pfam00373), at their amino terminus. This family represents the rest of these proteins.


Pssm-ID: 250119 [Multi-domain]  Cd Length: 244  Bit Score: 43.59  E-value: 9.58e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312619   363 RLQMLRLSEMLEQDAREAvLGDLKQIEELSNRSTSGDQGGDGAKGELEVLAVAFQTMSSRIREQ-------HERLESLIA 435
Cdd:pfam00769   7 LQELEERLEQMEEDMRMA-QKALEEYERKALELEEKLQQEEEEAELLEKKADELEEMNRRLEEEamaqeeeKERLEAERD 85
                          90       100       110
                  ....*....|....*....|....*....|..
gi 83312619   436 ERTRDVEILREALRTRDQLAA-LRQELDFARE 466
Cdd:pfam00769  86 EATAEVAKLEVAREKKEAEKEqLQQELREARE 117
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH