NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|83312538|ref|YP_422802|]
View 

response regulator [Magnetospirillum magneticum AMB-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
4-119 3.29e-33

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 119.99  E-value: 3.29e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReeMQDVPVVVVTT 83
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEK-EGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTA 77
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 83312538  84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:cd00156  78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
151-282 2.16e-25

Metal dependent phosphohydrolases with conserved 'HD' motif


:

Pssm-ID: 238032  Cd Length: 145  Bit Score: 99.72  E-value: 2.16e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 151 TGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMIllkpdrlSETEFTIMKQHAMYGWEILKDSSSQL 230
Cdd:cd00077   3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRELLLEE 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538 231 VR-----LAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYK 282
Cdd:cd00077  76 VIklideLILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSREK 132
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
4-326 5.38e-108

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


:

Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 322.39  E-value: 5.38e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRR-EEMQDVPVVVVT 82
Cdd:COG3437  18 LLVDDEPDNLEALR-QLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMsPSTRRIPVILLT 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQSRLALHDRAA---------------------EELVMRLS 141
Cdd:COG3437  97 AYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKRNEDFLLDQNLylelqelrrrteelaqiednlDETLEELA 176
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 142 KAAEYRDPETGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMILLKPDRLSETEFTIMKQHAMYGWE 221
Cdd:COG3437 177 ALLEVRDYETGDHLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGHPILGAE 256
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 222 ILKdSSSQLVRLAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYKTPWPVDKAAAFLGEQKGCH 301
Cdd:COG3437 257 ILK-SSERLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVSGRPYKEAMSTEEALEIIRAQSGRL 335
                       330       340
                ....*....|....*....|....*
gi 83312538 302 FDPACVDAFLSDLGEVLRIKAQFLD 326
Cdd:COG3437 336 FDPKLVEAFIQVEDEIIDIARRFAD 360
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
4-119 3.29e-33

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 119.99  E-value: 3.29e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReeMQDVPVVVVTT 83
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEK-EGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTA 77
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 83312538  84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:cd00156  78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
151-282 2.16e-25

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 99.72  E-value: 2.16e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 151 TGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMIllkpdrlSETEFTIMKQHAMYGWEILKDSSSQL 230
Cdd:cd00077   3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRELLLEE 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538 231 VR-----LAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYK 282
Cdd:cd00077  76 VIklideLILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSREK 132
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
4-116 2.77e-29

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 109.20  E-value: 2.77e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVVVTT 83
Cdd:pfam00072   2 LIVDDDPLIRELLR-QLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPP--TTPVIVLTA 78
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTR 116
Cdd:pfam00072  79 HGDEEDAVEALKAGANDFLSKPFDPEELLAALR 111
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
4-125 3.14e-23

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 92.99  E-value: 3.14e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESA-LDALAWCEANT-PDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVV 81
Cdd:COG0784   9 LVVDDEPVNRRLLK-RLLEDLGYEVVEAADGeEEALELLRELPqPDLILLDINMPGMDGIELLRRLRARG--PNIPVILL 85
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
gi 83312538  82 TTSDVKEIRQQALDLGAADFLTKPVDGPE-LMARTRNLLALRQSR 125
Cdd:COG0784  86 TAYADEADRERALAAGADDYLTKPIFLEEeLLAALRRLLARAAAE 130
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
151-275 1.15e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 71.50  E-value: 1.15e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   151 TGAHIERMARYSALIARRMGLPNeaVERLELAAPMHDVGKVGIPDMILLkpdrlsetEFTIMKQHAMYGWEILKDS-SSQ 229
Cdd:pfam01966   1 VLEHSLRVALLARELAEELGELD--RELLLLAALLHDIGKPPFGDEKPL--------LFEIFLGHAVVGAEILRELeKPL 70
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 83312538   230 LVRLAALIARTHHEKFdgsgypEGLAGDKIPLEGRIVAVADVFDAL 275
Cdd:pfam01966  71 GLEDVLKLILEHHESW------EGLYGEPISLEARIVKLADRLDAL 110
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
148-282 2.23e-15

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 71.17  E-value: 2.23e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    148 DPETGAHIERMARYSALIARRMGLPNeaVERLELAAPMHDVGKVGIPDMILLKpdrlseteFTIMKQHAMYGWEILKDS- 226
Cdd:smart00471   2 DYHVFEHSLRVAQLAAALAEELGLLD--IELLLLAALLHDIGKPGTPDSFLVK--------TSVLEDHHFIGAEILLEEe 71
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538    227 -SSQLVRLAALIARTHHEKFDgsgypeGLAGDKIPLEGRIVAVADVFDALTSTRPYK 282
Cdd:smart00471  72 ePRILEEILRTAILSHHERPD------GLRGEPITLEARIVKVADRLDALRADRRYR 122
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
4-56 6.77e-10

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 54.11  E-value: 6.77e-10
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 83312538      4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMP 56
Cdd:smart00448   4 LVVDDDPLLRELLK-ALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
4-105 9.20e-10

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 55.37  E-value: 9.20e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:PRK10610   9 LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTA 88
                         90       100
                 ....*....|....*....|..
gi 83312538   84 SDVKEIRQQALDLGAADFLTKP 105
Cdd:PRK10610  89 EAKKENIIAAAQAGASGYVVKP 110
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
4-326 5.38e-108

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 322.39  E-value: 5.38e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRR-EEMQDVPVVVVT 82
Cdd:COG3437  18 LLVDDEPDNLEALR-QLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMsPSTRRIPVILLT 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQSRLALHDRAA---------------------EELVMRLS 141
Cdd:COG3437  97 AYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKRNEDFLLDQNLylelqelrrrteelaqiednlDETLEELA 176
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 142 KAAEYRDPETGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMILLKPDRLSETEFTIMKQHAMYGWE 221
Cdd:COG3437 177 ALLEVRDYETGDHLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGHPILGAE 256
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 222 ILKdSSSQLVRLAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYKTPWPVDKAAAFLGEQKGCH 301
Cdd:COG3437 257 ILK-SSERLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVSGRPYKEAMSTEEALEIIRAQSGRL 335
                       330       340
                ....*....|....*....|....*
gi 83312538 302 FDPACVDAFLSDLGEVLRIKAQFLD 326
Cdd:COG3437 336 FDPKLVEAFIQVEDEIIDIARRFAD 360
pleD PRK09581
response regulator PleD; Reviewed
4-155 4.31e-23

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 98.05  E-value: 4.31e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:PRK09581   6 LVVDDIPANVKLLEAKLLA-EYYTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATTHIPVVMVTA 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRqsrlALHDraaeELVMRLSKAAE----------YRDPETGA 153
Cdd:PRK09581  85 LDDPEDRVRGLEAGADDFLTKPINDVALFARVKSLTRLK----MVID----ELRLRASTNAEigvtalmimaYANKDEDG 156

                 ..
gi 83312538  154 HI 155
Cdd:PRK09581 157 RI 158
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
4-119 5.67e-22

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 91.62  E-value: 5.67e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:TIGR02154   6 LVVEDEPAIRELIAYNLEK-AGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPETRAIPIIMLTA 84
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:TIGR02154  85 RGEEEDRVRGLETGADDYITKPFSPRELLARIKAVL 120
orf27 CHL00148
Ycf27; Reviewed
4-119 1.03e-14

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 71.29  E-value: 1.03e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLiKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVVVVTT 83
Cdd:CHL00148  10 LVVDDEAYIRKILETRL-SIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIRKE---SDVPIIMLTA 85
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 83312538   84 -SDVKEiRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:CHL00148  86 lGDVSD-RITGLELGADDYVVKPFSPKELEARIRSVL 121
PLN03029 PLN03029
type-a response regulator protein; Provisional
4-106 8.19e-13

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 65.44  E-value: 8.19e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAW--------CEANTP------------DIILTDYMMPGMDGLDF 63
Cdd:PLN03029  12 LAVDDSLIDRKLIE-KLLKTSSYQVTTVDSGSKALKFlglheddrSNPDTPsvspnshqevevNLIITDYCMPGMTGYDL 90
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 83312538   64 IRQVRRREEMQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:PLN03029  91 LKKIKESSSLRNIPVVIMSSENVPSRITRCLEEGAEEFFLKPV 133
 
Name Accession Description Interval E-value
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
4-119 3.29e-33

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 119.99  E-value: 3.29e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReeMQDVPVVVVTT 83
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEK-EGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKR--GPDIPIIFLTA 77
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 83312538  84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:cd00156  78 HGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
151-282 2.16e-25

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032  Cd Length: 145  Bit Score: 99.72  E-value: 2.16e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 151 TGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMIllkpdrlSETEFTIMKQHAMYGWEILKDSSSQL 230
Cdd:cd00077   3 RFEHSLRVAQLARRLAEELGLSEEDIELLRLAALLHDIGKPGTPDAI-------TEEESELEKDHAIVGAEILRELLLEE 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538 231 VR-----LAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYK 282
Cdd:cd00077  76 VIklideLILAVDASHHERLDGLGYPDGLKGEEITLEARIVKLADRLDALRRDSREK 132
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
4-116 2.77e-29

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 249561  Cd Length: 111  Bit Score: 109.20  E-value: 2.77e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVVVTT 83
Cdd:pfam00072   2 LIVDDDPLIRELLR-QLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLELLRRIRRRPP--TTPVIVLTA 78
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTR 116
Cdd:pfam00072  79 HGDEEDAVEALKAGANDFLSKPFDPEELLAALR 111
CheY COG0784
FOG: CheY-like receiver [Signal transduction mechanisms]
4-125 3.14e-23

FOG: CheY-like receiver [Signal transduction mechanisms]


Pssm-ID: 223855  Cd Length: 130  Bit Score: 92.99  E-value: 3.14e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESA-LDALAWCEANT-PDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVV 81
Cdd:COG0784   9 LVVDDEPVNRRLLK-RLLEDLGYEVVEAADGeEEALELLRELPqPDLILLDINMPGMDGIELLRRLRARG--PNIPVILL 85
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
gi 83312538  82 TTSDVKEIRQQALDLGAADFLTKPVDGPE-LMARTRNLLALRQSR 125
Cdd:COG0784  86 TAYADEADRERALAAGADDYLTKPIFLEEeLLAALRRLLARAAAE 130
HD pfam01966
HD domain; HD domains are metal dependent phosphohydrolases.
151-275 1.15e-15

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 251000  Cd Length: 110  Bit Score: 71.50  E-value: 1.15e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   151 TGAHIERMARYSALIARRMGLPNeaVERLELAAPMHDVGKVGIPDMILLkpdrlsetEFTIMKQHAMYGWEILKDS-SSQ 229
Cdd:pfam01966   1 VLEHSLRVALLARELAEELGELD--RELLLLAALLHDIGKPPFGDEKPL--------LFEIFLGHAVVGAEILRELeKPL 70
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 83312538   230 LVRLAALIARTHHEKFdgsgypEGLAGDKIPLEGRIVAVADVFDAL 275
Cdd:pfam01966  71 GLEDVLKLILEHHESW------EGLYGEPISLEARIVKLADRLDAL 110
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic ...
148-282 2.23e-15

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679  Cd Length: 124  Bit Score: 71.17  E-value: 2.23e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    148 DPETGAHIERMARYSALIARRMGLPNeaVERLELAAPMHDVGKVGIPDMILLKpdrlseteFTIMKQHAMYGWEILKDS- 226
Cdd:smart00471   2 DYHVFEHSLRVAQLAAALAEELGLLD--IELLLLAALLHDIGKPGTPDSFLVK--------TSVLEDHHFIGAEILLEEe 71
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538    227 -SSQLVRLAALIARTHHEKFDgsgypeGLAGDKIPLEGRIVAVADVFDALTSTRPYK 282
Cdd:smart00471  72 ePRILEEILRTAILSHHERPD------GLRGEPITLEARIVKVADRLDALRADRRYR 122
HD_5 pfam13487
HD domain; HD domains are metal dependent phosphohydrolases.
202-265 3.73e-14

HD domain; HD domains are metal dependent phosphohydrolases.


Pssm-ID: 257811  Cd Length: 63  Bit Score: 66.43  E-value: 3.73e-14
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 83312538   202 DRLSETEFTIMKQHAMYGWEILkdssSQLVRLA--ALIARTHHEKFDGSGYPEGLAGDKIPLEGRI 265
Cdd:pfam13487   1 GTLTPEERAIINEHPEQTARLL----EKIPRLPpvAEIIGHHHERLDGSGYPRGLKGDEIPLGARI 62
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
4-56 6.77e-10

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 54.11  E-value: 6.77e-10
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 83312538      4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMP 56
Cdd:smart00448   4 LVVDDDPLLRELLK-ALLEKEGYEVDEATDGEEALELLKEEKPDLILLDIMMP 55
PRK10610 PRK10610
chemotaxis regulatory protein CheY; Provisional
4-105 9.20e-10

chemotaxis regulatory protein CheY; Provisional


Pssm-ID: 170568  Cd Length: 129  Bit Score: 55.37  E-value: 9.20e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:PRK10610   9 LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTA 88
                         90       100
                 ....*....|....*....|..
gi 83312538   84 SDVKEIRQQALDLGAADFLTKP 105
Cdd:PRK10610  89 EAKKENIIAAAQAGASGYVVKP 110
COG3437 COG3437
Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription ...
4-326 5.38e-108

Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 322.39  E-value: 5.38e-108
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRR-EEMQDVPVVVVT 82
Cdd:COG3437  18 LLVDDEPDNLEALR-QLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMsPSTRRIPVILLT 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQSRLALHDRAA---------------------EELVMRLS 141
Cdd:COG3437  97 AYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKRNEDFLLDQNLylelqelrrrteelaqiednlDETLEELA 176
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 142 KAAEYRDPETGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMILLKPDRLSETEFTIMKQHAMYGWE 221
Cdd:COG3437 177 ALLEVRDYETGDHLERVAQYSELLAELLGLSEEEVDLIKKAAPLHDIGKVAIPDSILLKPGKLTSEEFEIMKGHPILGAE 256
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 222 ILKdSSSQLVRLAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYKTPWPVDKAAAFLGEQKGCH 301
Cdd:COG3437 257 ILK-SSERLMQVAAEIARHHHERWDGSGYPDGLKGDEIPLSARIVAIADVFDALVSGRPYKEAMSTEEALEIIRAQSGRL 335
                       330       340
                ....*....|....*....|....*
gi 83312538 302 FDPACVDAFLSDLGEVLRIKAQFLD 326
Cdd:COG3437 336 FDPKLVEAFIQVEDEIIDIARRFAD 360
COG2206 COG2206
c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]
145-316 1.64e-65

c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms]


Pssm-ID: 225116 [Multi-domain]  Cd Length: 344  Bit Score: 212.35  E-value: 1.64e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 145 EYRDPETGAHIERMARYSALIARRMGLPNEAVERLELAAPMHDVGKVGIPDMILLKPDRLSETEFTIMKQHAMYGWEILK 224
Cdd:COG2206 143 KAKDDYTYGHSVRVAELAEAIAKKLGLSEEKIEELALAGLLHDIGKIGIPDSILNKPGKLTEEEFEIIKKHPIYGYDILK 222
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538 225 DSSsQLVRLAALIARTHHEKFDGSGYPEGLAGDKIPLEGRIVAVADVFDALTSTRPYKTPWPVDKAAAFLGEQKGCHFDP 304
Cdd:COG2206 223 DLP-EFLESVRAVALRHHERWDGTGYPRGLKGEEIPLEARIIAVADVYDALTSDRPYKKAKSPEEALEELRKNSGGKFDP 301
                       170
                ....*....|..
gi 83312538 305 ACVDAFLSDLGE 316
Cdd:COG2206 302 KVVDAFLKALSK 313
OmpR COG0745
Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding ...
1-137 2.53e-24

Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 98.52  E-value: 2.53e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   1 MIALLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANtPDIILTDYMMPGMDGLDFIRQVRRREEMQdVPVVV 80
Cdd:COG0745   1 MRILLVEDDPELAELLKEYLEE-EGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGLELCRRLRAKKGSG-PPIIV 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 83312538  81 VTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLlaLRQSRLALHDRAAEELV 137
Cdd:COG0745  78 LTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRAL--LRRNAGASRAEASEVLV 132
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
4-141 1.66e-23

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 98.93  E-value: 1.66e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:COG3706 136 LVVDDDATQRERLRRILQV-EGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLRQLERTRDIPIILLSS 214
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 83312538  84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLlaLRQSRLALHDRAAEELVMRLS 141
Cdd:COG3706 215 KDDDELVVRAFELGVNDYITKPIEEGELRARLRRQ--LRRKRYERQLRESLERLQELA 270
pleD PRK09581
response regulator PleD; Reviewed
4-155 4.31e-23

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 98.05  E-value: 4.31e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:PRK09581   6 LVVDDIPANVKLLEAKLLA-EYYTVLTASSGAEAIAICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATTHIPVVMVTA 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRqsrlALHDraaeELVMRLSKAAE----------YRDPETGA 153
Cdd:PRK09581  85 LDDPEDRVRGLEAGADDFLTKPINDVALFARVKSLTRLK----MVID----ELRLRASTNAEigvtalmimaYANKDEDG 156

                 ..
gi 83312538  154 HI 155
Cdd:PRK09581 157 RI 158
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
4-119 5.67e-22

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 91.62  E-value: 5.67e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:TIGR02154   6 LVVEDEPAIRELIAYNLEK-AGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLRRRPETRAIPIIMLTA 84
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:TIGR02154  85 RGEEEDRVRGLETGADDYITKPFSPRELLARIKAVL 120
CitB COG2197
Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain ...
4-145 3.31e-20

Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 86.20  E-value: 3.31e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLIKIEGCEVVC-MESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReeMQDVPVVVVT 82
Cdd:COG2197   4 LIVDDHPLVREGLRQLLELEPDLEVVGeASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRAR--GPDIKVVVLT 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARtrnLLALRQSRLALHDRAAEELVMRLSKAAE 145
Cdd:COG2197  82 AHDDPAYVIRALRAGADGYLLKDASPEELVEA---IRAVAAGGTYLPPDIARKLAGLLPSSSA 141
AtoC COG2204
Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains ...
4-123 5.24e-20

Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 89.29  E-value: 5.24e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLiKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVVVT- 82
Cdd:COG2204   8 LVVDDDPDIRELLEQAL-ELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDP--DLPVIVMTg 84
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 83312538  83 TSDVKEIrQQALDLGAADFLTKPVDGPELMARTRNLLALRQ 123
Cdd:COG2204  85 HGDIDTA-VEALRLGAFDFLEKPFDLDRLLAIVERALELRE 124
cztR_silR_copR TIGR01387
heavy metal response regulator; Members of this family contain a response regulator receiver ...
4-125 4.86e-15

heavy metal response regulator; Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system.


Pssm-ID: 130454 [Multi-domain]  Cd Length: 218  Bit Score: 71.75  E-value: 4.86e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVVTT 83
Cdd:TIGR01387   2 LVVEDEQKTAEYLQQGLSE-SGYVVDAASNGRDGLHLALKDDYDLIILDVMLPGMDGWQILQTLRRSG--KQTPVLFLTA 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLlaLRQSR 125
Cdd:TIGR01387  79 RDSVADKVKGLDLGADDYLVKPFSFSELLARVRTL--LRRSH 118
TtrR COG4566
Response regulator [Signal transduction mechanisms]
19-134 4.90e-15

Response regulator [Signal transduction mechanisms]


Pssm-ID: 226932 [Multi-domain]  Cd Length: 202  Bit Score: 71.55  E-value: 4.90e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  19 RLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFirQVRRREEMQDVPVVVVTT-SDVkEIRQQALDLG 97
Cdd:COG4566  22 FLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLEL--QDRLAERGIRLPVIFLTGhGDI-PMAVQAMKAG 98
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 83312538  98 AADFLTKPVDGPELMARTRNLLALRQSRLALHDRAAE 134
Cdd:COG4566  99 AVDFLEKPFSEQDLLDAVERALARDASRRAEADRQAA 135
PRK10841 PRK10841
hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional
1-106 9.95e-15

hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional


Pssm-ID: 182772 [Multi-domain]  Cd Length: 924  Bit Score: 73.85  E-value: 9.95e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPTNLMLLKHRLIKIeGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRqvRRREEMQDVPVVV 80
Cdd:PRK10841 802 MMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALNVLSKNHIDIVLTDVNMPNMDGYRLTQ--RLRQLGLTLPVIG 878
                         90       100
                 ....*....|....*....|....*.
gi 83312538   81 VTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:PRK10841 879 VTANALAEEKQRCLEAGMDSCLSKPV 904
orf27 CHL00148
Ycf27; Reviewed
4-119 1.03e-14

Ycf27; Reviewed


Pssm-ID: 214376 [Multi-domain]  Cd Length: 240  Bit Score: 71.29  E-value: 1.03e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLiKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVVVVTT 83
Cdd:CHL00148  10 LVVDDEAYIRKILETRL-SIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGYGVCQEIRKE---SDVPIIMLTA 85
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 83312538   84 -SDVKEiRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:CHL00148  86 lGDVSD-RITGLELGADDYVVKPFSPKELEARIRSVL 121
COG4753 COG4753
Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain ...
4-111 1.99e-14

Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 72.39  E-value: 1.99e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHrLIKIE--GCEVV-CMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVV 80
Cdd:COG4753   5 LIVDDEPLIREGLKS-LIDWEalGIEVVgTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQS--PDTEFII 81
                        90       100       110
                ....*....|....*....|....*....|.
gi 83312538  81 VTTSDVKEIRQQALDLGAADFLTKPVDGPEL 111
Cdd:COG4753  82 LSGYDEFEYAKKAMKLGVKDYLLKPVDKAEL 112
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
46-119 3.60e-14

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 69.75  E-value: 3.60e-14
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 83312538   46 PDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK10161  47 PDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120
PRK10710 PRK10710
DNA-binding transcriptional regulator BaeR; Provisional
36-119 5.37e-14

DNA-binding transcriptional regulator BaeR; Provisional


Pssm-ID: 182665 [Multi-domain]  Cd Length: 240  Bit Score: 69.33  E-value: 5.37e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   36 DALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRreeMQDVPVVVVtTSDVKEI-RQQALDLGAADFLTKPVDGPELMAR 114
Cdd:PRK10710  45 EVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRR---FSDIPIVMV-TAKIEEIdRLLGLEIGADDYICKPYSPREVVAR 120

                 ....*
gi 83312538  115 TRNLL 119
Cdd:PRK10710 121 VKTIL 125
PRK11107 PRK11107
hybrid sensory histidine kinase BarA; Provisional
4-107 1.45e-13

hybrid sensory histidine kinase BarA; Provisional


Pssm-ID: 236848 [Multi-domain]  Cd Length: 919  Bit Score: 70.26  E-value: 1.45e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLML----LKHRLIKIEGCEvvcmeSALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVV 79
Cdd:PRK11107 671 MAVDDNPANLKLigalLEEQVEHVVLCD-----SGHQAVEQAKQRPFDLILMDIQMPGMDGIRACELIRQLPHNQNTPII 745
                         90       100
                 ....*....|....*....|....*...
gi 83312538   80 VVTTSDVKEIRQQALDLGAADFLTKPVD 107
Cdd:PRK11107 746 AVTAHAMAGERERLLSAGMDDYLAKPID 773
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
4-134 3.62e-13

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].


Pssm-ID: 233585 [Multi-domain]  Cd Length: 463  Bit Score: 68.61  E-value: 3.62e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdVPVVVVTT 83
Cdd:TIGR01818   2 WVVDDDRSIRWVLEKALSR-AGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQ--LPVIVMTA 78
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQSRLALHDRAAE 134
Cdd:TIGR01818  79 HSDLDTAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHAQEQVALPADAGE 129
PRK10955 PRK10955
DNA-binding transcriptional regulator CpxR; Provisional
4-119 3.90e-13

DNA-binding transcriptional regulator CpxR; Provisional


Pssm-ID: 182864 [Multi-domain]  Cd Length: 232  Bit Score: 66.75  E-value: 3.90e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHrLIKIEGCEVVCMESALDALAWCEaNTPDIILTDYMMPGMDGLDFIRQVRRREEmqdVPVVVVTT 83
Cdd:PRK10955   5 LLVDDDRELTSLLKE-LLEMEGFNVIVAHDGEQALDLLD-DSIDLLLLDVMMPKKNGIDTLKELRQTHQ---TPVIMLTA 79
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK10955  80 RGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 115
PLN03029 PLN03029
type-a response regulator protein; Provisional
4-106 8.19e-13

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 65.44  E-value: 8.19e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAW--------CEANTP------------DIILTDYMMPGMDGLDF 63
Cdd:PLN03029  12 LAVDDSLIDRKLIE-KLLKTSSYQVTTVDSGSKALKFlglheddrSNPDTPsvspnshqevevNLIITDYCMPGMTGYDL 90
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 83312538   64 IRQVRRREEMQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:PLN03029  91 LKKIKESSSLRNIPVVIMSSENVPSRITRCLEEGAEEFFLKPV 133
PRK10643 PRK10643
DNA-binding transcriptional regulator BasR; Provisional
1-123 8.24e-13

DNA-binding transcriptional regulator BasR; Provisional


Pssm-ID: 182612 [Multi-domain]  Cd Length: 222  Bit Score: 65.44  E-value: 8.24e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNptnlMLLKHRLIKI---EGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRreEMQDVP 77
Cdd:PRK10643   1 MKILIVEDD----TLLLQGLILAlqtEGYACDCASTAREAEALLESGHYSLVVLDLGLPDEDGLHLLRRWRQ--KKYTLP 74
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 83312538   78 VVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQ 123
Cdd:PRK10643  75 VLILTARDTLEDRVAGLDVGADDYLVKPFALEELHARIRALIRRHQ 120
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
24-123 1.18e-12

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 65.21  E-value: 1.18e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   24 EGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRrreEMQDVPVVVVTTSDVKEIRQQALDLGAADFLT 103
Cdd:PRK10529  24 DGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLR---QWSAIPVIVLSARSEESDKIAALDAGADDYLS 100
                         90       100
                 ....*....|....*....|
gi 83312538  104 KPVDGPELMARTRnlLALRQ 123
Cdd:PRK10529 101 KPFGIGELQARLR--VALRR 118
CheB COG2201
Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase ...
1-149 2.44e-12

Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 225111 [Multi-domain]  Cd Length: 350  Bit Score: 65.78  E-value: 2.44e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   1 MIALLIDDNPTNLMLLKHRLIKIEGCEVV-CMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVV 79
Cdd:COG2201   2 IRVLVVDDSALMRKVISDILNSDPDIEVVgTARNGREAIDKVKKLKPDVITLDVEMPVMDGLEALRKIMRL---RPLPVI 78
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 83312538  80 VV--TTSDVKEIRQQALDLGAADFLTKPVDGPELmartrNLLALRQSRLALHDRAAEELVMRLSKAAEYRDP 149
Cdd:COG2201  79 MVssLTEEGAEATLEALELGAVDFIAKPSGGISL-----GLDEVAELLIEKVRAAARQNRKSLRTPEPPRAP 145
PleD COG3706
Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal ...
27-145 2.81e-12

Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 65.81  E-value: 2.81e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  27 EVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRqvRRREEMQdvPVVVVTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:COG3706  14 EVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCR--RLKAEPA--TVVMVTALDDSAPRVRGLKAGADDFLTKPV 89
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 83312538 107 DGPELMARTRNLLALRQSrlalhdraAEELVMRLSKAAE 145
Cdd:COG3706  90 NDSQLFLRAKSLVRLKCS--------IDELRLREETGGE 120
PRK00742 PRK00742
chemotaxis-specific methylesterase; Provisional
35-108 3.35e-12

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 234828 [Multi-domain]  Cd Length: 354  Bit Score: 65.56  E-value: 3.35e-12
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 83312538   35 LDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdvPVVVVT--TSDVKEIRQQALDLGAADFLTKPVDG 108
Cdd:PRK00742  39 LEAREKIKKLNPDVITLDVEMPVMDGLDALEKIMRLRPT---PVVMVSslTERGAEITLRALELGAVDFVTKPFLG 111
glnG PRK10923
nitrogen regulation protein NR(I); Provisional
5-113 9.15e-12

nitrogen regulation protein NR(I); Provisional


Pssm-ID: 182842 [Multi-domain]  Cd Length: 469  Bit Score: 64.51  E-value: 9.15e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    5 LIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdVPVVVVTTS 84
Cdd:PRK10923   8 VVDDDSSIRWVLE-RALAGAGLTCTTFENGNEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPM--LPVIIMTAH 84
                         90       100
                 ....*....|....*....|....*....
gi 83312538   85 DVKEIRQQALDLGAADFLTKPVDGPELMA 113
Cdd:PRK10923  85 SDLDAAVSAYQQGAFDYLPKPFDIDEAVA 113
spore_0_A TIGR02875
sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a ...
4-118 1.27e-11

sporulation transcription factor Spo0A; Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species [Cellular processes, Sporulation and germination].


Pssm-ID: 131922 [Multi-domain]  Cd Length: 262  Bit Score: 62.89  E-value: 1.27e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKIEGCEVVCM-ESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVT 82
Cdd:TIGR02875   6 VIADDNKEFCNLLKEYLAAQPDMEVVGVaHNGVDALELIKEQQPDVVVLDIIMPHLDGIGVLEKLNEIELSARPRVIMLS 85
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 83312538    83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNL 118
Cdd:TIGR02875  86 AFGQEKITQRAVALGADYYVLKPFDLEILAARIRQL 121
PRK15479 PRK15479
transcriptional regulatory protein TctD; Provisional
1-130 1.36e-11

transcriptional regulatory protein TctD; Provisional


Pssm-ID: 185376 [Multi-domain]  Cd Length: 221  Bit Score: 62.05  E-value: 1.36e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVV 80
Cdd:PRK15479   1 MRLLLAEDNRELAHWLEKALVQ-NGFAVDCVFDGLAADHLLQSEMYALAVLDINMPGMDGLEVLQRLRKRG--QTLPVLL 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   81 VTT-SDVKEiRQQALDLGAADFLTKPVDGPELMARTRNLL---------ALRQSRLALHD 130
Cdd:PRK15479  78 LTArSAVAD-RVKGLNVGADDYLPKPFELEELDARLRALLrrsagqvqeVQQLGELIFHD 136
PRK10693 PRK10693
response regulator of RpoS; Provisional
30-127 1.85e-11

response regulator of RpoS; Provisional


Pssm-ID: 182652 [Multi-domain]  Cd Length: 303  Bit Score: 62.70  E-value: 1.85e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   30 CMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVVVT-TSDVKEIrQQALDLGAADFLTKPVdg 108
Cdd:PRK10693   2 LAANGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLRNRGD--QTPVLVISaTENMADI-AKALRLGVQDVLLKPV-- 76
                         90
                 ....*....|....*....
gi 83312538  109 pelmartRNLLALRQSRLA 127
Cdd:PRK10693  77 -------KDLNRLREMVFA 88
PRK10816 PRK10816
DNA-binding transcriptional regulator PhoP; Provisional
1-127 3.46e-11

DNA-binding transcriptional regulator PhoP; Provisional


Pssm-ID: 182755 [Multi-domain]  Cd Length: 223  Bit Score: 60.91  E-value: 3.46e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPtnlmLLKHRL---IKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRqvRRREEMQDVP 77
Cdd:PRK10816   1 MRVLVVEDNA----LLRHHLkvqLQDAGHQVDAAEDAKEADYYLNEHLPDIAIVDLGLPDEDGLSLIR--RWRSNDVSLP 74
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 83312538   78 VVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLAlRQSRLA 127
Cdd:PRK10816  75 ILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMR-RNSGLA 123
PRK12555 PRK12555
chemotaxis-specific methylesterase; Provisional
1-133 3.55e-11

chemotaxis-specific methylesterase; Provisional


Pssm-ID: 237135 [Multi-domain]  Cd Length: 337  Bit Score: 62.21  E-value: 3.55e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPTNLMLLKHRLIKIEGCEVV-CMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdvPVV 79
Cdd:PRK12555   1 MRIGIVNDSPLAVEALRRALARDPDHEVVwVATDGAQAVERCAAQPPDVILMDLEMPRMDGVEATRRIMAERPC---PIL 77
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 83312538   80 VVtTSDVK---EIRQQALDLGAADFLTKPVDGP---------ELMARTRNLLALRQSRLALHDRAA 133
Cdd:PRK12555  78 IV-TSLTErnaSRVFEAMGAGALDAVDTPTLGIgagleeyaaELLAKIDQIGRLLGRRLAPAAAPA 142
PRK15115 PRK15115
response regulator GlrR; Provisional
4-139 4.72e-11

response regulator GlrR; Provisional


Pssm-ID: 185070 [Multi-domain]  Cd Length: 444  Bit Score: 62.16  E-value: 4.72e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVVVTT 83
Cdd:PRK15115   9 LLVDDDPGLLKLLGMRLTS-EGYSVVTAESGQEALRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQP--GMPVIILTA 85
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   84 ----SDVKEIRQQaldlGAADFLTKPVDGPELMARTRNllALRQSRLALHDRAAEELVMR 139
Cdd:PRK15115  86 hgsiPDAVAATQQ----GVFSFLTKPVDRDALYKAIDD--ALEQSAPATDERWREAIVTR 139
PRK10651 PRK10651
transcriptional regulator NarL; Provisional
4-178 7.27e-11

transcriptional regulator NarL; Provisional


Pssm-ID: 182619 [Multi-domain]  Cd Length: 216  Bit Score: 59.66  E-value: 7.27e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPtnlMLLK--HRLIKIEGCEVVCMESA--LDALAWCEANTPDIILTDYMMPGMDGLDFIRQVrrREEMQDVPVV 79
Cdd:PRK10651  10 LLIDDHP---MLRTgvKQLISMAPDITVVGEASngEQGIELAESLDPDLILLDLNMPGMNGLETLDKL--REKSLSGRIV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   80 VVTTSDVKEIRQQALDLGAADFLTKPVDgPELMartrnLLALRQS---RLALHDRAAEELVMRLSKAAEYRDPETGAHIE 156
Cdd:PRK10651  85 VFSVSNHEEDVVTALKRGADGYLLKDME-PEDL-----LKALQQAaagEMVLSEALTPVLAASLRANRATTERDVNQLTP 158
                        170       180
                 ....*....|....*....|..
gi 83312538  157 RMARYSALIARrmGLPNEAVER 178
Cdd:PRK10651 159 RERDILKLIAQ--GLPNKMIAR 178
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
4-129 9.20e-11

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 61.40  E-value: 9.20e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVVTT 83
Cdd:PRK11361   7 ILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHE--TRTPVILMTA 84
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPE---LMARTRNLLALRQSRLALH 129
Cdd:PRK11361  85 YAEVETAVEALRCGAFDYVIKPFDLDElnlIVQRALQLQSMKKEIRHLH 133
fixJ PRK09390
response regulator FixJ; Provisional
20-134 1.57e-10

response regulator FixJ; Provisional


Pssm-ID: 181815 [Multi-domain]  Cd Length: 202  Bit Score: 58.48  E-value: 1.57e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   20 LIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdVPVVVVTT-SDVKeIRQQALDLGA 98
Cdd:PRK09390  22 LLDSAGFEVRLFESAQAFLDALPGLRFGCVVTDVRMPGIDGIELLRRLKARGSP--LPVIVMTGhGDVP-LAVEAMKLGA 98
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 83312538   99 ADFLTKPVDGPELMARTRNLLALRQSRLALHDRAAE 134
Cdd:PRK09390  99 VDFIEKPFEDERLIGAIERALAQAPEAAKSEAVAAD 134
PRK10701 PRK10701
DNA-binding transcriptional regulator RstA; Provisional
37-146 3.17e-10

DNA-binding transcriptional regulator RstA; Provisional


Pssm-ID: 236738 [Multi-domain]  Cd Length: 240  Bit Score: 58.11  E-value: 3.17e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   37 ALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVVVVTT--SDVKEIrqQALDLGAADFLTKPVDGPELMAR 114
Cdd:PRK10701  37 AEATILREQPDLVLLDIMLPGKDGMTICRDLRPK---WQGPIVLLTSldSDMNHI--LALEMGACDYILKTTPPAVLLAR 111
                         90       100       110
                 ....*....|....*....|....*....|..
gi 83312538  115 TRnlLALRQSRLALHDRAAEELVMRLSKAAEY 146
Cdd:PRK10701 112 LR--LHLRQNEQATQTKGLQETSLTPYKALHF 141
COG3947 COG3947
Response regulator containing CheY-like receiver and SARP domains [Signal transduction ...
1-123 4.11e-10

Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]


Pssm-ID: 226456 [Multi-domain]  Cd Length: 361  Bit Score: 59.10  E-value: 4.11e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   1 MIALLIDDNPTNLMLLKHRLIKIeGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqDVPVVV 80
Cdd:COG3947   1 PRIIIVDDDAAIVKLLSVILSRA-GHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIES--AVPIIF 77
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 83312538  81 VTTSDvkEIRQQALDLGAADFLTKPVDGPEL----MARTRNLLALRQ 123
Cdd:COG3947  78 ISSHA--EYADDSFGMNLDDYLPKPVTPEKLnraiDRRLKRVELTAE 122
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription / Signal transduction ...
4-106 4.65e-10

Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 57.65  E-value: 4.65e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPtnlML--LKHRLIK-IEGCEVV----CMESALDALAWCEantPDIILTDYMMPGMDGLDFIRQVrrREEMQDV 76
Cdd:COG4565   4 LIIEDDP---MVaeIHRRYVKqIPGFSVVgtagTLEEAKMIIEEFK---PDLILLDIYMPDGNGIELLPEL--RSQHYPV 75
                        90       100       110
                ....*....|....*....|....*....|
gi 83312538  77 PVVVVTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:COG4565  76 DVIVITAASDMETIKEALRYGVVDYLIKPF 105
PRK11517 PRK11517
transcriptional regulatory protein YedW; Provisional
1-119 1.14e-09

transcriptional regulatory protein YedW; Provisional


Pssm-ID: 183172 [Multi-domain]  Cd Length: 223  Bit Score: 56.45  E-value: 1.14e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEmqdVPVVV 80
Cdd:PRK11517   1 MKILLIEDNQRTQEWVTQGLSE-AGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQ---TPVIC 76
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 83312538   81 VTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK11517  77 LTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQL 115
PRK09836 PRK09836
DNA-binding transcriptional activator CusR; Provisional
47-119 1.27e-09

DNA-binding transcriptional activator CusR; Provisional


Pssm-ID: 182102 [Multi-domain]  Cd Length: 227  Bit Score: 56.47  E-value: 1.27e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83312538   47 DIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK09836  46 DLIILDIMLPDVNGWDIVRMLRSAN--KGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLL 116
PRK09483 PRK09483
response regulator; Provisional
1-116 1.37e-09

response regulator; Provisional


Pssm-ID: 236538 [Multi-domain]  Cd Length: 217  Bit Score: 55.88  E-value: 1.37e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIA-LLIDDNPTNLMLLKHRLIKIEGCEVVC-MESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReeMQDVPV 78
Cdd:PRK09483   1 MINvLLVDDHELVRAGIRRILEDIKGIKVVGeACCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKILRY--TPDVKI 78
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 83312538   79 VVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTR 116
Cdd:PRK09483  79 IMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIR 116
ompR PRK09468
osmolarity response regulator; Provisional
4-125 1.96e-09

osmolarity response regulator; Provisional


Pssm-ID: 181883 [Multi-domain]  Cd Length: 239  Bit Score: 56.14  E-value: 1.96e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPtNLMLLKHRLIKIEGCEVVCMESA--LDALawCEANTPDIILTDYMMPGMDGLDFIRqvRRREEMQDVPVVVV 81
Cdd:PRK09468   9 LVVDDDM-RLRALLERYLTEQGFQVRSAANAeqMDRL--LTRESFHLMVLDLMLPGEDGLSICR--RLRSQNNPTPIIML 83
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 83312538   82 TT--SDVKEIrqQALDLGAADFLTKPVDGPELMARTRNLLAlRQSR 125
Cdd:PRK09468  84 TAkgEEVDRI--VGLEIGADDYLPKPFNPRELLARIRAVLR-RQAP 126
PRK10336 PRK10336
DNA-binding transcriptional regulator QseB; Provisional
47-119 1.13e-08

DNA-binding transcriptional regulator QseB; Provisional


Pssm-ID: 182387 [Multi-domain]  Cd Length: 219  Bit Score: 53.36  E-value: 1.13e-08
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 83312538   47 DIILTDYMMPGMDGLDFIRQvrRREEMQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK10336  46 DAVILDLTLPGMDGRDILRE--WREKGQREPVLILTARDALAERVEGLRLGADDYLCKPFALIEVAARLEALM 116
PRK15369 PRK15369
two component system sensor kinase SsrB; Provisional
32-113 1.21e-08

two component system sensor kinase SsrB; Provisional


Pssm-ID: 185267 [Multi-domain]  Cd Length: 211  Bit Score: 53.16  E-value: 1.21e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   32 ESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRR-EEMQdvpVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPE 110
Cdd:PRK15369  36 DNGLEVYNACRQLEPDIVILDLGLPGMNGLDVIPQLHQRwPAMN---ILVLTARQEEHMASRTLAAGALGYVLKKSPQQI 112

                 ...
gi 83312538  111 LMA 113
Cdd:PRK15369 113 LLA 115
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
4-119 1.30e-08

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 53.12  E-value: 1.30e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKiEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVVVVTT 83
Cdd:PRK10766   6 LVVEDEPVTRARLQGYFEQ-EGYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELRSR---STVGIILVTG 81
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLL 119
Cdd:PRK10766  82 RTDSIDRIVGLEMGADDYVTKPLELRELLVRVKNLL 117
PRK11091 PRK11091
aerobic respiration control sensor protein ArcB; Provisional
4-113 1.44e-08

aerobic respiration control sensor protein ArcB; Provisional


Pssm-ID: 236842 [Multi-domain]  Cd Length: 779  Bit Score: 54.95  E-value: 1.44e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKIeGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVVTT 83
Cdd:PRK11091 529 LLVEDIELNVIVARSVLEKL-GNSVDVAMTGKEALEMFDPDEYDLVLLDIQLPDMTGLDIARELRERYPREDLPPLVALT 607
                         90       100       110
                 ....*....|....*....|....*....|
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMA 113
Cdd:PRK11091 608 ANVLKDKKEYLDAGMDDVLSKPLSVPALTA 637
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
4-120 3.53e-08

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412 [Multi-domain]  Cd Length: 441  Bit Score: 53.11  E-value: 3.53e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMqdVPVVVVTT 83
Cdd:PRK10365   9 LVVDDDISHCTILQ-ALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPA--IPVLIMTA 85
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 83312538   84 SDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLA 120
Cdd:PRK10365  86 YSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALA 122
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
4-120 3.66e-08

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems].


Pssm-ID: 234070 [Multi-domain]  Cd Length: 968  Bit Score: 53.63  E-value: 3.66e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKHRLIKIeGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRRE-EMQDVPVVVVT 82
Cdd:TIGR02956 706 LLVEDNEVNQMVAQGFLTRL-GHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQLRAIYgAKNEVKFIAFS 784
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 83312538    83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLA 120
Cdd:TIGR02956 785 AHVFNEDVAQYLAAGFDGFLAKPVVEEQLTAMIAVILA 822
pleD PRK09581
response regulator PleD; Reviewed
4-116 5.40e-08

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 52.60  E-value: 5.40e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPtnlmLLKHRLIKIEGCE--VVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDVPVVVV 81
Cdd:PRK09581 159 LLVDDDV----SQAERIANILKEEfrVVVVSDPSEALFNAAETNYDLVIVSANFENYDPLRLCSQLRSKERTRYVPILLL 234
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 83312538   82 TTSDVKEIRQQALDLGAADFLTKPVDGPELMARTR 116
Cdd:PRK09581 235 VDEDDDPRLVKALELGVNDYLMRPIDKNELLARVR 269
PRK11083 PRK11083
DNA-binding response regulator CreB; Provisional
24-119 6.63e-08

DNA-binding response regulator CreB; Provisional


Pssm-ID: 236838 [Multi-domain]  Cd Length: 228  Bit Score: 51.12  E-value: 6.63e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   24 EGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPVVVVTTSDvKEI-RQQALDLGAADFL 102
Cdd:PRK11083  26 EGFTVEWFERGLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLAFH--PALPVIFLTARS-DEVdRLVGLEIGADDYV 102
                         90
                 ....*....|....*..
gi 83312538  103 TKPVDGPELMARTRNLL 119
Cdd:PRK11083 103 AKPFSPREVAARVRTIL 119
LytT COG3279
Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]
1-145 6.71e-08

Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]


Pssm-ID: 225818 [Multi-domain]  Cd Length: 244  Bit Score: 51.59  E-value: 6.71e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   1 MIALLI-DDNPTNLMLLKHRLIKIEGCEVVCM-ESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREemQDVPV 78
Cdd:COG3279   1 MLKVLIvDDEPLAREELRRILNEIPDIEIVGEaENGEEALQLLQGLRPDLVFLDIAMPDINGIELAARIRKGD--PRPAI 78
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 83312538  79 VVVTTsdVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLALRQSRL--ALHDRAAEELVMRLSKAAE 145
Cdd:COG3279  79 VFVTA--HDEYAVAAFEVEALDYLLKPISEERLAKTLERLRRYAQLQLleLLADTEKVLRFIPIKGGER 145
AmiR COG3707
Response regulator with putative antiterminator output domain [Signal transduction mechanisms]
4-159 1.55e-07

Response regulator with putative antiterminator output domain [Signal transduction mechanisms]


Pssm-ID: 226230 [Multi-domain]  Cd Length: 194  Bit Score: 49.64  E-value: 1.55e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKHRLiKIEGCEVV-CMESALDALAWCEANTPDIILTDYMMPGmdgLDFIRQVRRREEMQDVPVVVVT 82
Cdd:COG3707   9 LVADDEALTRMDIREGL-LEAGYQRVgEAADGLEAVEVCERLQPDVVILDIEMPR---RDIIEALLLASENVARPIVALT 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPEL-------MARTRNLLALRQSRLALHDRAAEELVMRLSKA---AEYRDPETG 152
Cdd:COG3707  85 AYSDPALIEAAIEAGVMAYIVKPLDESRLlpildvaVSRFEERRALRRELAKLKDRLEERKVIERAKGllmKRRGLSEEE 164

                ....*....
gi 83312538 153 A--HIERMA 159
Cdd:COG3707 165 AykLLRRTA 173
COG4567 COG4567
Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal ...
4-113 2.15e-07

Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]


Pssm-ID: 226933 [Multi-domain]  Cd Length: 182  Bit Score: 48.96  E-value: 2.15e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVR-RREEMQdvpVVVVT 82
Cdd:COG4567  13 LLVDDDTPFLRTLA-RAMERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGLAVIEALReRRADMR---IVVLT 88
                        90       100       110
                ....*....|....*....|....*....|.
gi 83312538  83 TSDVKEIRQQALDLGAADFLTKPVDGPELMA 113
Cdd:COG4567  89 GYASIATAVEAVKLGACDYLAKPADADDILA 119
PRK09959 PRK09959
hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
4-106 2.23e-07

hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional


Pssm-ID: 182169 [Multi-domain]  Cd Length: 1197  Bit Score: 51.27  E-value: 2.23e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTNLMLLKhRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVrrREEMQDVPVVVVTT 83
Cdd:PRK09959  962 LIADDHPTNRLLLK-RQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKL--REQNSSLPIWGLTA 1038
                          90       100
                  ....*....|....*....|...
gi 83312538    84 SDVKEIRQQALDLGAADFLTKPV 106
Cdd:PRK09959 1039 NAQANEREKGLSCGMNLCLFKPL 1061
PRK09958 PRK09958
DNA-binding transcriptional activator EvgA; Provisional
1-113 5.09e-07

DNA-binding transcriptional activator EvgA; Provisional


Pssm-ID: 182168 [Multi-domain]  Cd Length: 204  Bit Score: 48.35  E-value: 5.09e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLIDDNPTNLMLLKHRLIKiEGCEVVC-MESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRReEMQDVPVV 79
Cdd:PRK09958   1 MNAIIIDDHPLAIAAIRNLLIK-NDIEILAeLTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKR-QYSGIIII 78
                         90       100       110
                 ....*....|....*....|....*....|....
gi 83312538   80 VVTTSDVKEIRQQAlDLGAADFLTKPVDGPELMA 113
Cdd:PRK09958  79 VSAKNDHFYGKHCA-DAGANGFVSKKEGMNNIIA 111
PRK15347 PRK15347
two component system sensor kinase SsrA; Provisional
4-106 9.28e-07

two component system sensor kinase SsrA; Provisional


Pssm-ID: 237951 [Multi-domain]  Cd Length: 921  Bit Score: 49.26  E-value: 9.28e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNL-----MLlkHRLikieGCEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQD--V 76
Cdd:PRK15347 694 LLVDDVETNRdiigmML--VEL----GQQVTTAASGTEALELGRQHRFDLVLMDIRMPGLDGLETTQLWRDDPNNLDpdC 767
                         90       100       110
                 ....*....|....*....|....*....|
gi 83312538   77 PVVVVTTSDVKEIRQQALDLGAADFLTKPV 106
Cdd:PRK15347 768 MIVALTANAAPEEIHRCKKAGMNHYLTKPV 797
PRK13856 PRK13856
two-component response regulator VirG; Provisional
45-131 1.43e-06

two-component response regulator VirG; Provisional


Pssm-ID: 172377 [Multi-domain]  Cd Length: 241  Bit Score: 47.50  E-value: 1.43e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   45 TPDIILTDYMMPGMDGLDFIRQVRRReemQDVPVVVVTTSDVKEIRQQ-ALDLGAADFLTKPVDGPELMARTRNLLALRQ 123
Cdd:PRK13856  45 TVDVVVVDLNLGREDGLEIVRSLATK---SDVPIIIISGDRLEEADKVvALELGATDFIAKPFGTREFLARIRVALRVRP 121

                 ....*...
gi 83312538  124 SRLALHDR 131
Cdd:PRK13856 122 NVVRTKDR 129
PRK11173 PRK11173
two-component response regulator; Provisional
42-135 1.69e-06

two-component response regulator; Provisional


Pssm-ID: 183013 [Multi-domain]  Cd Length: 237  Bit Score: 47.32  E-value: 1.69e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   42 EANTPDIILTDYMMPGMDGLDFIRQVRrreEMQDVPVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELMARTRNLLal 121
Cdd:PRK11173  44 SENDINLVIMDINLPGKNGLLLARELR---EQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLL-- 118
                         90
                 ....*....|....
gi 83312538  122 rqSRLALHDRAAEE 135
Cdd:PRK11173 119 --SRTMNLGTVSEE 130
PRK10430 PRK10430
DNA-binding transcriptional activator DcuR; Provisional
1-105 1.45e-04

DNA-binding transcriptional activator DcuR; Provisional


Pssm-ID: 182454 [Multi-domain]  Cd Length: 239  Bit Score: 41.25  E-value: 1.45e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MIALLI-DDNPTNLMLLKHRLIKIEG---CEVVCMESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRREEMQDV 76
Cdd:PRK10430   1 MINVLIvDDDAMVAELNRRYVAQIPGfqcCGTASTLEQAKEIIFNSDTPIDLILLDIYMQQENGLDLLPVLHEAGCKSDV 80
                         90       100
                 ....*....|....*....|....*....
gi 83312538   77 pVVVVTTSDVKEIrQQALDLGAADFLTKP 105
Cdd:PRK10430  81 -IVISSAADAATI-KDSLHYGVVDYLIKP 107
PRK11697 PRK11697
putative two-component response-regulatory protein YehT; Provisional
1-125 1.93e-04

putative two-component response-regulatory protein YehT; Provisional


Pssm-ID: 236956 [Multi-domain]  Cd Length: 238  Bit Score: 40.99  E-value: 1.93e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    1 MI-ALLIDDNPTNLMLLKHRLIKIEGCEVV--CmESALDALAWCEANTPDIILTDYMMPGMDGLDFIrqvrrreEMQD-- 75
Cdd:PRK11697   1 MIkVLIVDDEPLAREELRELLQEEGDIEIVgeC-SNAIEAIGAIHRLKPDVVFLDIQMPRISGLELV-------GMLDpe 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 83312538   76 -VP-VVVVTTSDvkEIRQQALDLGAADFLTKPVDgPELMARTrnLLALRQSR 125
Cdd:PRK11697  73 hMPyIVFVTAFD--EYAIKAFEEHAFDYLLKPID-PARLAKT--LARLRQER 119
PRK10403 PRK10403
transcriptional regulator NarP; Provisional
4-116 2.23e-04

transcriptional regulator NarP; Provisional


Pssm-ID: 182431 [Multi-domain]  Cd Length: 215  Bit Score: 40.61  E-value: 2.23e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538    4 LLIDDNPTNLMLLKHRLIKIEGCEVVC-MESALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRreEMQDVPVVVVT 82
Cdd:PRK10403  10 LIVDDHPLMRRGVRQLLELDPGFEVVAeAGDGASAIDLANRLDPDVILLDLNMKGMSGLDTLNALRR--DGVTAQIIILT 87
                         90       100       110
                 ....*....|....*....|....*....|....
gi 83312538   83 TSDVKEIRQQALDLGAADFLTKPVDGPELMARTR 116
Cdd:PRK10403  88 VSDASSDVFALIDAGADGYLLKDSDPEVLLEAIR 121
PRK10360 PRK10360
DNA-binding transcriptional activator UhpA; Provisional
33-187 2.28e-04

DNA-binding transcriptional activator UhpA; Provisional


Pssm-ID: 182408 [Multi-domain]  Cd Length: 196  Bit Score: 40.35  E-value: 2.28e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   33 SALDALAWCEANTPDIILTDYMMPGMDGLDFIRQVRRreemqDVPVVVVTTSDVKEIRQQALDLGAADFLTKPVDGPELM 112
Cdd:PRK10360  35 SGREALAGLPGRGVQVCICDISMPDISGLELLSQLPK-----GMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELI 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538  113 ARTRN---------------LLALRQSRLALHDRAAEELVMR----LSKAAEYRDPETGAHIERmarysALIARRMGLPN 173
Cdd:PRK10360 110 AAVHTvatggcyltpdiaikLASGRQDPLTKRERQVAEKLAQgmavKEIAAELGLSPKTVHVHR-----ANLMEKLGVSN 184
                        170
                 ....*....|....
gi 83312538  174 EaverLELAAPMHD 187
Cdd:PRK10360 185 D----VELARRMFD 194
PEP_resp_reg TIGR02915
PEP-CTERM-box response regulator transcription factor; Members of this protein family share ...
4-111 4.46e-04

PEP-CTERM-box response regulator transcription factor; Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see SP|Q06065). These proteins have a Fis family DNA binding sequence (pfam02954), a response regulator receiver domain (pfam00072), and sigma-54 interaction domain (pfam00158) [Regulatory functions, DNA interactions].


Pssm-ID: 234057 [Multi-domain]  Cd Length: 445  Bit Score: 40.50  E-value: 4.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538     4 LLIDDNPTnlmLLKHRLIKIEGCEVVCMESALDALAWCEANTPDIILTDYMMP-----GMDGLDFIRQVRRREEmqDVPV 78
Cdd:TIGR02915   2 LIVEDDLG---LQKQLKWSFADYELAVAADRESAIALVRRHEPAVVTLDLGLPpdadgASEGLAALQQILAIAP--DTKV 76
                          90       100       110
                  ....*....|....*....|....*....|...
gi 83312538    79 VVVTTSDVKEIRQQALDLGAADFLTKPVDGPEL 111
Cdd:TIGR02915  77 IVITGNDDRENAVKAIGLGAYDFYQKPIDPDVL 109
PRK13557 PRK13557
histidine kinase; Provisional
34-119 1.11e-03

histidine kinase; Provisional


Pssm-ID: 237425 [Multi-domain]  Cd Length: 540  Bit Score: 39.27  E-value: 1.11e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   34 ALDALAwcEANTPDIILTDYMMPG-MDGLDFIRQVRRReemqdVPVV-VVTTSDVKEIRQQALDLGAADF--LTKPVDGP 109
Cdd:PRK13557 451 ALEILD--SHPEVDLLFTDLIMPGgMNGVMLAREARRR-----QPKIkVLLTTGYAEASIERTDAGGSEFdiLNKPYRRA 523
                         90
                 ....*....|
gi 83312538  110 ELMARTRNLL 119
Cdd:PRK13557 524 ELARRVRMVL 533
PRK13558 PRK13558
bacterio-opsin activator; Provisional
37-134 1.37e-03

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 39.05  E-value: 1.37e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 83312538   37 ALAWCEANTPDIILTDYMMPGMDGLDFIRQVrrREEMQDVPVVVVTTSDVKEIRQQALDLGAADFLtkPVDGPELMARTR 116
Cdd:PRK13558  43 ARDRVEAGEIDCVVADHEPDGFDGLALLEAV--RQTTAVPPVVVVPTAGDEAVARRAVDADAAAYV--PAVSDDATAAIA 118
                         90
                 ....*....|....*...
gi 83312538  117 NLLAlrqSRLALHDRAAE 134
Cdd:PRK13558 119 ERIE---SAVPEHSRDTE 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH