NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|82948243|dbj|BAE53107|]
View 

Methyl-accepting chemotaxis protein [Magnetospirillum magneticum AMB-1]

Protein classification: methyl-accepting chemotaxis protein (MCP) is a bacterial receptor that mediates chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behavior

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
361-406 5.58e-04

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


:

Pssm-ID: 100122  Cd Length: 48  Bit Score: 38.38  E-value: 5.58e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 82948243 361 ISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEVFKRN 406
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVT-GRDEIGELARAFNQMAER 45
MCP_signal super family cl21547
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
476-667 3.49e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 148.92  E-value: 3.49e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 476 DMGDAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTN 555
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 556 LLALNATIEAARAGEAGKGFAVVAGEVKHLANQTARATEDISRQVEGIQDSTQ-------GMAERIGEVVGLIRTLDGVS 628
Cdd:cd11386  82 LLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEeaveameETSEEVEEGVELVEETGRAF 161
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 82948243 629 SAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLA 667
Cdd:cd11386 162 EEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
283-701 3.19e-46

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 169.40  E-value: 3.19e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 283 RALTGAKVIRQAERSGLPVAALAAPIPDYSGKPAAVVEIVMDSRDYAAEYVEARTNAI-----IGAVIILALGLLAVWLL 357
Cdd:COG0840   1 SNLEAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVlkfllISLLVAIIVVLVLAILL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 358 ARGISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEvfkrnaldkrRMEDEAQELRRQedlaraardeaaae 437
Cdd:COG0840  81 LRAILEPISDLLEVVERIAAGDLTKRIDES-SNDEFGQLAKSFN----------EMILNLRQIIDA-------------- 135
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 438 halgVQAKVASVDKATDAIRSTAKAMSQRSERSGSlsldmgdAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQ 517
Cdd:COG0840 136 ----VQDNAEALSGASEEIAASATELSARADQQAE-------SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 518 KTVASVEETASQMEG-----------LSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLA 586
Cdd:COG0840 205 EGGEEVRQAVEQMQEiaeelaevvkkLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLA 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 587 NQTARATEDISRQVEGIQDST-------QGMAERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKV 659
Cdd:COG0840 285 ERSADSAKEIGLLIEEIQNEAadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEI 364
                       410       420       430       440
                ....*....|....*....|....*....|....*....|..
gi 82948243 660 SGAVSQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:COG0840 365 NASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
361-406 5.58e-04

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 38.38  E-value: 5.58e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 82948243 361 ISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEVFKRN 406
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVT-GRDEIGELARAFNQMAER 45
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
476-667 3.49e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 148.92  E-value: 3.49e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 476 DMGDAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTN 555
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 556 LLALNATIEAARAGEAGKGFAVVAGEVKHLANQTARATEDISRQVEGIQDSTQ-------GMAERIGEVVGLIRTLDGVS 628
Cdd:cd11386  82 LLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEeaveameETSEEVEEGVELVEETGRAF 161
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 82948243 629 SAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLA 667
Cdd:cd11386 162 EEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
340-406 2.06e-08

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 51.85  E-value: 2.06e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82948243   340 IIGAVIILALGLLAVWLLARGISLPLQGITRVMHTLAAGDLSVEAPfTHRGDEVGEMARAVEVFKRN 406
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAFNQMADR 67
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
359-412 4.29e-04

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 38.77  E-value: 4.29e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 82948243    359 RGISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEVFKRNALDKRR 412
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLPVD-GRDEIGELARAFNEMADRLEETIA 53
HAMP COG2770
HAMP domain [Signal transduction mechanisms];
335-408 2.79e-03

HAMP domain [Signal transduction mechanisms];


Pssm-ID: 225359  Cd Length: 83  Bit Score: 36.58  E-value: 2.79e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 82948243 335 ARTNAIIGAVIILALGLLaVWLLARGISLPLQGITRVMHTLAAGDLSVEAPfTHRGDEVGEMARAVEVFKRNAL 408
Cdd:COG2770   5 APIFGLLVLALVLILAVL-LLAAARRVTRPLRRLADLAQNLALGDLSAEIP-QPMLDEIGELAKAFNRMRDSLQ 76
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
283-701 3.19e-46

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 169.40  E-value: 3.19e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 283 RALTGAKVIRQAERSGLPVAALAAPIPDYSGKPAAVVEIVMDSRDYAAEYVEARTNAI-----IGAVIILALGLLAVWLL 357
Cdd:COG0840   1 SNLEAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVlkfllISLLVAIIVVLVLAILL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 358 ARGISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEvfkrnaldkrRMEDEAQELRRQedlaraardeaaae 437
Cdd:COG0840  81 LRAILEPISDLLEVVERIAAGDLTKRIDES-SNDEFGQLAKSFN----------EMILNLRQIIDA-------------- 135
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 438 halgVQAKVASVDKATDAIRSTAKAMSQRSERSGSlsldmgdAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQ 517
Cdd:COG0840 136 ----VQDNAEALSGASEEIAASATELSARADQQAE-------SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 518 KTVASVEETASQMEG-----------LSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLA 586
Cdd:COG0840 205 EGGEEVRQAVEQMQEiaeelaevvkkLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLA 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 587 NQTARATEDISRQVEGIQDST-------QGMAERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKV 659
Cdd:COG0840 285 ERSADSAKEIGLLIEEIQNEAadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEI 364
                       410       420       430       440
                ....*....|....*....|....*....|....*....|..
gi 82948243 660 SGAVSQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:COG0840 365 NASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
453-701 2.77e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.68  E-value: 2.77e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    453 TDAIRSTAKAMSQRSERSGSLSLDMGDAAQITSEratvVSEATRQLALSVDEIAHQVSCANDVTQKTVAS-------VEE 525
Cdd:smart00283   3 SEAVEEIAAGAEEQAEELEELAERMEELSASIEE----VAANADEIAATAQSAAEAAEEGREAVEDAITAmdqirevVEE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    526 TASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLANQTARATEDISRQVEGIQD 605
Cdd:smart00283  79 AVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQE 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    606 STQGMA-------ERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLAQASAKTCAGTI 678
Cdd:smart00283 159 ETNEAVaameessSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSE 238
                          250       260
                   ....*....|....*....|...
gi 82948243    679 RVMWSAKGLAQTVDGLTSETESF 701
Cdd:smart00283 239 EISAAAEELSGLAEELDELVERF 261
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
512-701 1.58e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 122.55  E-value: 1.58e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   512 ANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLANQTAR 591
Cdd:pfam00015  14 ALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQ 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   592 ATEDISRQVEGIQDSTQGMAERIGEV-------VGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAVS 664
Cdd:pfam00015  94 AAKEIEALIEEIVKQTNDSTASIQQTrtevevgSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVA 173
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 82948243   665 QLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:pfam00015 174 RIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
338-701 1.08e-25

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 110.55  E-value: 1.08e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  338 NAIIGAVIILALGLL---AVWLLARGISLPLQGITRVMHTLAAGDLsveapfthrgdevgemARAVEVFKRNALDKRRME 414
Cdd:PRK09793 188 SALVFISMIIVAAIYissALWWTRKMIVQPLAIIGSHFDSIAAGNL----------------ARPIAVYGRNEITAIFAS 251
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  415 DEAQELRRQEDLARaardeaaaehalgVQAKVASVDKATDAIRSTAKAMSQRSER-SGSLSLDMGDAAQITserATVVSE 493
Cdd:PRK09793 252 LKTMQQALRGTVSD-------------VRKGSQEMHIGIAEIVAGNNDLSSRTEQqAASLAQTAASMEQLT---ATVGQN 315
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  494 ATRqlALSVDEIAHQvscANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGK 573
Cdd:PRK09793 316 ADN--ARQASELAKN---AATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGR 390
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  574 GFAVVAGEVKHLANQTARATEDISRQVEgiqdstqGMAERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVA 653
Cdd:PRK09793 391 GFAVVAGEVRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQR 463
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 82948243  654 RQADKVSGAVSQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:PRK09793 464 RGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
330-426 4.35e-08

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 55.17  E-value: 4.35e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   330 AEYVEARTNAIIGAVIILALGLLA-VWLLAR----GISLPLQGITRVMHTLAAGDLSVeaPFTHRGD-EVGEMARAVEVF 403
Cdd:TIGR02956 320 SDLLMTLSVAQFGLLITGMLGLVIlVFIMWRvvyrSVILRLNQHTQALLRLALGDLDI--SLDARGDdELAHMGRAIEAF 397
                          90       100
                  ....*....|....*....|....*...
gi 82948243   404 KRNALDKRRMEDE----AQELRR-QEDL 426
Cdd:TIGR02956 398 RDTAAHNLKLQADerqvAQELQEhKESL 425
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
361-406 5.58e-04

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 38.38  E-value: 5.58e-04
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 82948243 361 ISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEVFKRN 406
Cdd:cd06225   1 ILRPLRRLAEAAQRIAAGDLDVRLPVT-GRDEIGELARAFNQMAER 45
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
476-667 3.49e-41

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 148.92  E-value: 3.49e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 476 DMGDAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTN 555
Cdd:cd11386   2 ELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 556 LLALNATIEAARAGEAGKGFAVVAGEVKHLANQTARATEDISRQVEGIQDSTQ-------GMAERIGEVVGLIRTLDGVS 628
Cdd:cd11386  82 LLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEeaveameETSEEVEEGVELVEETGRAF 161
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 82948243 629 SAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLA 667
Cdd:cd11386 162 EEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
340-406 2.06e-08

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 51.85  E-value: 2.06e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 82948243   340 IIGAVIILALGLLAVWLLARGISLPLQGITRVMHTLAAGDLSVEAPfTHRGDEVGEMARAVEVFKRN 406
Cdd:pfam00672   2 LLVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVP-VSGPDEIGELARAFNQMADR 67
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
359-412 4.29e-04

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 38.77  E-value: 4.29e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 82948243    359 RGISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEVFKRNALDKRR 412
Cdd:smart00304   1 RRLLRPLRRLAEAAQRIADGDLTVRLPVD-GRDEIGELARAFNEMADRLEETIA 53
HAMP COG2770
HAMP domain [Signal transduction mechanisms];
335-408 2.79e-03

HAMP domain [Signal transduction mechanisms];


Pssm-ID: 225359  Cd Length: 83  Bit Score: 36.58  E-value: 2.79e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 82948243 335 ARTNAIIGAVIILALGLLaVWLLARGISLPLQGITRVMHTLAAGDLSVEAPfTHRGDEVGEMARAVEVFKRNAL 408
Cdd:COG2770   5 APIFGLLVLALVLILAVL-LLAAARRVTRPLRRLADLAQNLALGDLSAEIP-QPMLDEIGELAKAFNRMRDSLQ 76
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
283-701 3.19e-46

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 169.40  E-value: 3.19e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 283 RALTGAKVIRQAERSGLPVAALAAPIPDYSGKPAAVVEIVMDSRDYAAEYVEARTNAI-----IGAVIILALGLLAVWLL 357
Cdd:COG0840   1 SNLEAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVlkfllISLLVAIIVVLVLAILL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 358 ARGISLPLQGITRVMHTLAAGDLSVEAPFThRGDEVGEMARAVEvfkrnaldkrRMEDEAQELRRQedlaraardeaaae 437
Cdd:COG0840  81 LRAILEPISDLLEVVERIAAGDLTKRIDES-SNDEFGQLAKSFN----------EMILNLRQIIDA-------------- 135
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 438 halgVQAKVASVDKATDAIRSTAKAMSQRSERSGSlsldmgdAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQ 517
Cdd:COG0840 136 ----VQDNAEALSGASEEIAASATELSARADQQAE-------SLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAE 204
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 518 KTVASVEETASQMEG-----------LSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLA 586
Cdd:COG0840 205 EGGEEVRQAVEQMQEiaeelaevvkkLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLA 284
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 587 NQTARATEDISRQVEGIQDST-------QGMAERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKV 659
Cdd:COG0840 285 ERSADSAKEIGLLIEEIQNEAadavehmEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEI 364
                       410       420       430       440
                ....*....|....*....|....*....|....*....|..
gi 82948243 660 SGAVSQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:COG0840 365 NASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKF 406
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
453-701 2.77e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.68  E-value: 2.77e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    453 TDAIRSTAKAMSQRSERSGSLSLDMGDAAQITSEratvVSEATRQLALSVDEIAHQVSCANDVTQKTVAS-------VEE 525
Cdd:smart00283   3 SEAVEEIAAGAEEQAEELEELAERMEELSASIEE----VAANADEIAATAQSAAEAAEEGREAVEDAITAmdqirevVEE 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    526 TASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLANQTARATEDISRQVEGIQD 605
Cdd:smart00283  79 AVSAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQE 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    606 STQGMA-------ERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLAQASAKTCAGTI 678
Cdd:smart00283 159 ETNEAVaameessSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSE 238
                          250       260
                   ....*....|....*....|...
gi 82948243    679 RVMWSAKGLAQTVDGLTSETESF 701
Cdd:smart00283 239 EISAAAEELSGLAEELDELVERF 261
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
512-701 1.58e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 122.55  E-value: 1.58e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   512 ANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVKHLANQTAR 591
Cdd:pfam00015  14 ALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQ 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   592 ATEDISRQVEGIQDSTQGMAERIGEV-------VGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAVS 664
Cdd:pfam00015  94 AAKEIEALIEEIVKQTNDSTASIQQTrtevevgSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVA 173
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 82948243   665 QLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:pfam00015 174 RIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
338-701 1.08e-25

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 110.55  E-value: 1.08e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  338 NAIIGAVIILALGLL---AVWLLARGISLPLQGITRVMHTLAAGDLsveapfthrgdevgemARAVEVFKRNALDKRRME 414
Cdd:PRK09793 188 SALVFISMIIVAAIYissALWWTRKMIVQPLAIIGSHFDSIAAGNL----------------ARPIAVYGRNEITAIFAS 251
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  415 DEAQELRRQEDLARaardeaaaehalgVQAKVASVDKATDAIRSTAKAMSQRSER-SGSLSLDMGDAAQITserATVVSE 493
Cdd:PRK09793 252 LKTMQQALRGTVSD-------------VRKGSQEMHIGIAEIVAGNNDLSSRTEQqAASLAQTAASMEQLT---ATVGQN 315
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  494 ATRqlALSVDEIAHQvscANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGK 573
Cdd:PRK09793 316 ADN--ARQASELAKN---AATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGR 390
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  574 GFAVVAGEVKHLANQTARATEDISRQVEgiqdstqGMAERIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVA 653
Cdd:PRK09793 391 GFAVVAGEVRNLASRSAQAAKEIKGLIE-------ESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQR 463
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 82948243  654 RQADKVSGAVSQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:PRK09793 464 RGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVF 511
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
345-701 3.77e-24

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 105.86  E-value: 3.77e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  345 IILALGLLAVWLLARGISL-PLQGITRVMHTLAAGDLSVEAPFTHRgDEVGEMARAVEVFKRNALDKrrmedeaqelrrq 423
Cdd:PRK15048 199 LVVVLILLVAWYGIRRMLLtPLAKIIAHIREIAGGNLANTLTIDGR-SEMGDLAQSVSHMQRSLTDT------------- 264
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  424 edlaraardeaaaehalgvqakVASVDKATDAIRSTAKAMSQRSERSGSLSLDMGDAAQITSERATVVSEATRQLALSVD 503
Cdd:PRK15048 265 ----------------------VTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNAR 322
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  504 EIAHQVSCANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGEAGKGFAVVAGEVK 583
Cdd:PRK15048 323 QASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVR 402
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  584 HLANQTARATEDISRQVEgiqDSTQgmaeRIGEVVGLIRTLDGVSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAV 663
Cdd:PRK15048 403 NLASRSAQAAKEIKALIE---DSVS----RVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAV 475
                        330       340       350
                 ....*....|....*....|....*....|....*...
gi 82948243  664 SQLAQASAKTCAGTIRVMWSAKGLAQTVDGLTSETESF 701
Cdd:PRK15048 476 SEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAF 513
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
340-671 5.12e-23

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 102.34  E-value: 5.12e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  340 IIGAVIILALGLLAVWL-LARGISLPLQGITRVMHTLAAGDLsVEAPFTHRGDEVGEMARAVevfkrnaldkRRMEDEaq 418
Cdd:PRK15041 196 LVGVMIVVLAVIFAVWFgIKASLVAPMNRLIDSIRHIAGGDL-VKPIEVDGSNEMGQLAESL----------RHMQGE-- 262
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  419 elrrqedlaraardeaaaehalgVQAKVASVDKATDAIRSTAKA-------MSQRSE-RSGSLSLDMGDAAQITserATV 490
Cdd:PRK15041 263 -----------------------LMRTVGDVRNGANAIYSGASEiatgnndLSSRTEqQAASLEETAASMEQLT---ATV 316
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  491 vseatRQLALSVDEIAHQVSCANDVTQKTVASVEETASQMEGLSTAVRAIGDIVHLISDIASQTNLLALNATIEAARAGE 570
Cdd:PRK15041 317 -----KQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGE 391
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  571 AGKGFAVVAGEVKHLANQTARATEDISRQVEG-----------IQDSTQGMAE------RIGEVVGLI--------RTLD 625
Cdd:PRK15041 392 QGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDsvgkvdvgstlVESAGETMAEivsavtRVTDIMGEIasasdeqsRGID 471
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*.
gi 82948243  626 GVSSAIAgaiqQQDAATREIASNVEQVARQADKVSGAVSQLAQASA 671
Cdd:PRK15041 472 QVGLAVA----EMDRVTQQNAALVEESAAAAAALEEQASRLTEAVA 513
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
330-426 4.35e-08

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 55.17  E-value: 4.35e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   330 AEYVEARTNAIIGAVIILALGLLA-VWLLAR----GISLPLQGITRVMHTLAAGDLSVeaPFTHRGD-EVGEMARAVEVF 403
Cdd:TIGR02956 320 SDLLMTLSVAQFGLLITGMLGLVIlVFIMWRvvyrSVILRLNQHTQALLRLALGDLDI--SLDARGDdELAHMGRAIEAF 397
                          90       100
                  ....*....|....*....|....*...
gi 82948243   404 KRNALDKRRMEDE----AQELRR-QEDL 426
Cdd:TIGR02956 398 RDTAAHNLKLQADerqvAQELQEhKESL 425
PRK10549 PRK10549
signal transduction histidine-protein kinase BaeS; Provisional
336-421 1.23e-06

signal transduction histidine-protein kinase BaeS; Provisional


Pssm-ID: 182539 [Multi-domain]  Cd Length: 466  Bit Score: 50.02  E-value: 1.23e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243  336 RTNAIIGAVIILaLGLLAVWLLARGISLPLQGITRVMHTLAAGDLSVEAPFTHRgDEVGEMARAvevFKR--NALDK--- 410
Cdd:PRK10549 164 RTSWLIVALSTL-LAALATFLLARGLLAPVKRLVEGTHKLAAGDFTTRVTPTSR-DELGRLAQD---FNQlaSTLEKneq 238
                         90
                 ....*....|....
gi 82948243  411 -RR--MEDEAQELR 421
Cdd:PRK10549 239 mRRdfMADISHELR 252
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
442-544 8.81e-05

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 43.43  E-value: 8.81e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243    442 VQAKVASVDKATDAIRSTAKAMSQRSERSGSLSLDMGDAAQITSERATVVSEATRQLALSVDEIAHQVSCANDVTQKTVA 521
Cdd:smart00283 156 IQEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAA 235
                           90       100
                   ....*....|....*....|...
gi 82948243    522 SVEETASQMEGLSTAVRAIGDIV 544
Cdd:smart00283 236 MSEEISAAAEELSGLAEELDELV 258
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
442-534 9.71e-04

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 39.74  E-value: 9.71e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   442 VQAKVASVDKATDAIRSTAKAMSQRSERSGSLSLDMGDaaqitseratvVSEATRQLALSVDEIAHQVSCANDVTQKTVA 521
Cdd:pfam00015 116 IQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQE-----------IAAASDEQSAGIDQVNQAVARIDQVTQQNAA 184
                          90
                  ....*....|...
gi 82948243   522 SVEETASQMEGLS 534
Cdd:pfam00015 185 LVEESAAAAETLE 197
PHA03332 PHA03332
membrane glycoprotein; Provisional
454-636 2.48e-03

membrane glycoprotein; Provisional


Pssm-ID: 223047 [Multi-domain]  Cd Length: 1328  Bit Score: 39.95  E-value: 2.48e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   454 DAIRSTAKAMSQRSERSGSLSLD---MGDAAQITSERATVVSEATRQLALSVDEIAHQVSCANdvtqktvasvEETASQM 530
Cdd:PHA03332  831 DLWHETVKMFAPRRFGGSVMAGDaigLSAAAFTMASAALNAATQALAVATLYVNQLLQATAAT----------AEMASKI 900
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   531 EGLSTA-------VRAIGDIVHLISdIASQTNLLALNATIEAARAgEAGKGFAVVAGEVKHLANQTARATEDISRQVEGI 603
Cdd:PHA03332  901 GGLNARvdktsdvITKLGDTIAKIS-ATLDNNIRAVNGRVSDLED-QVNLRFLAVATNFNTLATQLKELGTTTNERIEEV 978
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 82948243   604 QDS--------------TQGmAERIGEVVGLIRTLdgVSSAIAGAIQ 636
Cdd:PHA03332  979 MAAalyyqqlnsltnqvTQS-ASKLGYQVGMYRTC--LKSLLAGTLA 1022
Reo_sigmaC pfam04582
Reovirus sigma C capsid protein;
464-561 3.45e-03

Reovirus sigma C capsid protein;


Pssm-ID: 113356 [Multi-domain]  Cd Length: 326  Bit Score: 38.75  E-value: 3.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   464 SQRSERSG-------SLSLDMGDAAQItSERATVVSEATRQLALSVDEIAHQVSCANDVTQKTVASVEETASQMEGLSTA 536
Cdd:pfam04582   7 SQRREVVGlilsltsSVTINPGDLTPI-YERLTNLESATASLSESVSTISSRLSDLSADLQDMTTSLDDAKATLNGLITT 85
                          90       100
                  ....*....|....*....|....*.
gi 82948243   537 VRAIGDIV-HLISDIASQTNLLALNA 561
Cdd:pfam04582  86 VQALQTSVdSLSSELADLSLTVSAHD 111
Mtu_fam_mce TIGR00996
virulence factor Mce family protein; Members of this paralogous family are found as six tandem ...
547-671 4.58e-03

virulence factor Mce family protein; Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis]


Pssm-ID: 273384 [Multi-domain]  Cd Length: 291  Bit Score: 38.42  E-value: 4.58e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   547 ISDIASQTNLLALNATIEAARAGEAGKGfavvagevkhlanqtaratEDISRQVEGIQDSTQGMAERIGEVVGLIRTLDG 626
Cdd:TIGR00996 139 LTRLLNGLDPEKLNAILNALAQALAGQG-------------------PQLRNLLDGLAQLTAALNERDGDIGELIRNLNR 199
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 82948243   627 VSSAIAGAIQQQDAATREIASNVEQVARQADKVSGAVSQLAQASA 671
Cdd:TIGR00996 200 VLDVLADRSDQLDRLLDNLPTLIATLADRSDALDDALAALSAASA 244
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
322-422 5.50e-03

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms];


Pssm-ID: 227333 [Multi-domain]  Cd Length: 712  Bit Score: 38.60  E-value: 5.50e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243 322 VMDSRDY----AAEYVEA---RTN-AIIGAVIILALGLL----AVW---LLARGISLPLQGITRVMHTLAAGDLSVEAPF 386
Cdd:COG5000 251 VAEHADLtegaAAEYRELeagRDGlQIAFALLYLSTALLvllaAIWtaiAFARRIVRPIRKLIEAADEVADGDLDVQVPV 330
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 82948243 387 THRGDEVGEMARAVEVFKRNALDKR----RMEDEAQELRR 422
Cdd:COG5000 331 RRVDEDVGRLSKAFNKMTEQLSSQQealeRAKDALEQRRR 370
DUF390 pfam04094
Protein of unknown function (DUF390); This is a family of long proteins currently only found ...
389-691 5.56e-03

Protein of unknown function (DUF390); This is a family of long proteins currently only found in the rice genome. They have no known function. However they may be some kind of transposable element.


Pssm-ID: 112890 [Multi-domain]  Cd Length: 843  Bit Score: 38.64  E-value: 5.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   389 RGDEVGEMARAVEVFKRNALDKRRMEDEAQ------------ELRRQEDLARAARDEAAAEHALGVQAKVASVDKaTDAI 456
Cdd:pfam04094 451 RKKDLAEIAKEVEEEREAALIATTVLNEAQddlrlqygsraaELEKKLDAAQGVLDAAAAREQRAAENEAASRQR-EEAL 529
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   457 RSTAKAMsqrSERSGSLSLDMGDaaqitSERATVVSEATrqLAlsvdeiAHQVSCANDVTQKTVA--SVEETASQMEGLS 534
Cdd:pfam04094 530 EARAMAL---EERACAKERDLAD-----REAAVAIREAT--LA------AHEAACAEEEFALRLRedALTERERALEEAE 593
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   535 TAVRAIGDIVHL---ISDIASQTNL-------LALN---ATIEA------ARAGEAGkgfaVVAGEvKHLANQTARATED 595
Cdd:pfam04094 594 AAAQQLADSLFLreaAQEEQARRNLegaraerAALDqraAELEArakeldARAHSGG----AAAGD-GDLAARLAAAEHS 668
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82948243   596 ISrQVEGIQDSTQGMAERI---GEV-VGLIRTldgvssaiagAIQQQDAATREI----------ASNVEQVARQADKVSG 661
Cdd:pfam04094 669 IA-DLQCALDSSAGEVEALrlaGEVgPGMLRD----------AVSRLDCAGRQAglwggrcakyAANQGGLAQRLSEMAG 737
                         330       340       350
                  ....*....|....*....|....*....|
gi 82948243   662 AVSQLAQASAKTCAGTIRVMwsAKGLAQTV 691
Cdd:pfam04094 738 ALQRLPEELEETIKSSSRDL--AQGAVELV 765
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH