NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|82946457|dbj|BAE51321|]
View 

Methyl-accepting chemotaxis protein [Magnetospirillum magneticum AMB-1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
13-154 2.78e-45

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


:

Pssm-ID: 238516  Cd Length: 147  Bit Score: 158.58  E-value: 2.78e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  13 DRLNFLRLDDDAVSAMTAVRPLVEGCLPAIADDFYAHLMKWPELQAMLGGGGRIGHLKQAQQAHWSALFSGRFDEDYFTR 92
Cdd:cd01068   5 ERLAFLGLDEDDLSLLKALRPVIEANADELVDRFYDHLRRTPETAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYIAQ 84
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82946457  93 AVAVGVTHERIGLGVNWYLGGYCFVLEKLIGDLHAKC-DKARFPEMAAAVLRAAFLDMDLAIS 154
Cdd:cd01068  85 RVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESIlSADELAQALRALIKLLDLDMDLVTS 147
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
213-392 1.45e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 122.35  E-value: 1.45e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 213 EAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSIAGQT 292
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 293 RMLALNATIEAARAGDMGKGFAVVADEVKRLA---------------KLTEEGIRGVNAqAHAIGQATDETVAMVEEVTA 357
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaakeieelieEIQEQTEEAVEA-MEETSEEVEEGVELVEETGR 159
                       170       180       190
                ....*....|....*....|....*....|....*
gi 82946457 358 SIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQ 392
Cdd:cd11386 160 AFEEIVASVEEVADGIQEISAATQEQSASTQEIAA 194
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
186-421 4.19e-34

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 131.25  E-value: 4.19e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    186 DIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAA 265
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    266 ATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLA-------KLTEEGIRGVNAQA 338
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAersaesaKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    339 HAIGQATDETVAMV--------------EEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSV 404
Cdd:smart00283 161 NEAVAAMEESSSEVeegvelveetgdalEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*..
gi 82946457    405 LNQAERTGATAQRVNEL 421
Cdd:smart00283 241 SAAAEELSGLAEELDEL 257
 
Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
13-154 2.78e-45

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 158.58  E-value: 2.78e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  13 DRLNFLRLDDDAVSAMTAVRPLVEGCLPAIADDFYAHLMKWPELQAMLGGGGRIGHLKQAQQAHWSALFSGRFDEDYFTR 92
Cdd:cd01068   5 ERLAFLGLDEDDLSLLKALRPVIEANADELVDRFYDHLRRTPETAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYIAQ 84
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82946457  93 AVAVGVTHERIGLGVNWYLGGYCFVLEKLIGDLHAKC-DKARFPEMAAAVLRAAFLDMDLAIS 154
Cdd:cd01068  85 RVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESIlSADELAQALRALIKLLDLDMDLVTS 147
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
12-162 5.03e-40

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 144.65  E-value: 5.03e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    12 RDRLNFLRLDDDAVSAMTAVRPLVEGCLPAIADDFYAHLMKWPELQAMLGGGGRIGHLKQAQQAHWSALFSGRFDEDYFT 91
Cdd:pfam11563   4 EYRLRFLGLTEEDLAALRALRPLIEPHIPAILDRFYEKLLSHPETARIFTDESQIERLKKTLRAYLLELFSGPYDEAYVE 83
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82946457    92 RAVAVGVTHERIGLGVNWYLGGYCFVLEKLIGDL--HAKCDKARFPEMAAAVLRAAFLDMDLAISTYIEHGEA 162
Cdd:pfam11563  84 YRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALleKIRLSAAELTALVRALSKLINLDQDLVLSAYEEELEE 156
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
213-392 1.45e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 122.35  E-value: 1.45e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 213 EAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSIAGQT 292
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 293 RMLALNATIEAARAGDMGKGFAVVADEVKRLA---------------KLTEEGIRGVNAqAHAIGQATDETVAMVEEVTA 357
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaakeieelieEIQEQTEEAVEA-MEETSEEVEEGVELVEETGR 159
                       170       180       190
                ....*....|....*....|....*....|....*
gi 82946457 358 SIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQ 392
Cdd:cd11386 160 AFEEIVASVEEVADGIQEISAATQEQSASTQEIAA 194
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
186-421 4.19e-34

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 131.25  E-value: 4.19e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    186 DIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAA 265
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    266 ATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLA-------KLTEEGIRGVNAQA 338
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAersaesaKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    339 HAIGQATDETVAMV--------------EEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSV 404
Cdd:smart00283 161 NEAVAAMEESSSEVeegvelveetgdalEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*..
gi 82946457    405 LNQAERTGATAQRVNEL 421
Cdd:smart00283 241 SAAAEELSGLAEELDEL 257
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
136-433 5.37e-30

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 122.02  E-value: 5.37e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 136 EMAAAVLRAAFLDMDLAIsTYIEHGEAGKMKRemlALSDTVDReVALTVGDIEKQVKRLIEGACELTGVASELKTMAEAV 215
Cdd:COG0840  90 DLLEVVERIAAGDLTKRI-DESSNDEFGQLAK---SFNEMILN-LRQIIDAVQDNAEALSGASEEIAASATELSARADQQ 164
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 216 AEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEG-----------LKDATGRIRDVVRL 284
Cdd:COG0840 165 AESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEiaeelaevvkkLSESSQEIEEITSV 244
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 285 IQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLAKLTEEGIRGVNAQAHAIGQAT--------------DETVA 350
Cdd:COG0840 245 INSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAadavehmeesasevSEGVK 324
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 351 MVEEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSVLNQAERTGATAQRVNELSVVVNRDVG 430
Cdd:COG0840 325 LVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVA 404

                ...
gi 82946457 431 DLQ 433
Cdd:COG0840 405 KFK 407
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
254-425 8.23e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 97.52  E-value: 8.23e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457   254 TDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLAKLTEEGirg 333
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQA--- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457   334 vnaqAHAIGQATDETVAMVEEVTASIQDINaiaQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSVLNQAERTGA 413
Cdd:pfam00015  95 ----AKEIEALIEEIVKQTNDSTASIQQTR---TEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQ 167
                         170
                  ....*....|..
gi 82946457   414 TAQRVNELSVVV 425
Cdd:pfam00015 168 VNQAVARIDQVT 179
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
197-425 2.44e-18

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 87.43  E-value: 2.44e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  197 GACELTGVASELKTMAEAVAEAV-------------------------SVTSDNVQSVAGASEALEETSRQISAKVHGTS 251
Cdd:PRK09793 241 GRNEITAIFASLKTMQQALRGTVsdvrkgsqemhigiaeivagnndlsSRTEQQAASLAQTAASMEQLTATVGQNADNAR 320
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  252 QLTDAAQQKMETA----------AATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVK 321
Cdd:PRK09793 321 QASELAKNAATTAqaggvqvstmTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVR 400
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  322 RLAK-----------LTEEGIRGVnaqaHAIGQATDETVAMVEEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQA 390
Cdd:PRK09793 401 NLASrsaqaakeikgLIEESVNRV----QQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQM 476
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 82946457  391 AQHTgtvHGHALSVLNQAERTGATAQRVNELSVVV 425
Cdd:PRK09793 477 DQVT---QQNASLVEEAAVATEQLANQADHLSSRV 508
 
Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
13-154 2.78e-45

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 158.58  E-value: 2.78e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  13 DRLNFLRLDDDAVSAMTAVRPLVEGCLPAIADDFYAHLMKWPELQAMLGGGGRIGHLKQAQQAHWSALFSGRFDEDYFTR 92
Cdd:cd01068   5 ERLAFLGLDEDDLSLLKALRPVIEANADELVDRFYDHLRRTPETAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYIAQ 84
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82946457  93 AVAVGVTHERIGLGVNWYLGGYCFVLEKLIGDLHAKC-DKARFPEMAAAVLRAAFLDMDLAIS 154
Cdd:cd01068  85 RVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESIlSADELAQALRALIKLLDLDMDLVTS 147
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
12-162 5.03e-40

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 144.65  E-value: 5.03e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    12 RDRLNFLRLDDDAVSAMTAVRPLVEGCLPAIADDFYAHLMKWPELQAMLGGGGRIGHLKQAQQAHWSALFSGRFDEDYFT 91
Cdd:pfam11563   4 EYRLRFLGLTEEDLAALRALRPLIEPHIPAILDRFYEKLLSHPETARIFTDESQIERLKKTLRAYLLELFSGPYDEAYVE 83
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82946457    92 RAVAVGVTHERIGLGVNWYLGGYCFVLEKLIGDL--HAKCDKARFPEMAAAVLRAAFLDMDLAISTYIEHGEA 162
Cdd:pfam11563  84 YRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALleKIRLSAAELTALVRALSKLINLDQDLVLSAYEEELEE 156
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
213-392 1.45e-31

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 122.35  E-value: 1.45e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 213 EAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSIAGQT 292
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 293 RMLALNATIEAARAGDMGKGFAVVADEVKRLA---------------KLTEEGIRGVNAqAHAIGQATDETVAMVEEVTA 357
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAeesaeaakeieelieEIQEQTEEAVEA-MEETSEEVEEGVELVEETGR 159
                       170       180       190
                ....*....|....*....|....*....|....*
gi 82946457 358 SIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQ 392
Cdd:cd11386 160 AFEEIVASVEEVADGIQEISAATQEQSASTQEIAA 194
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
186-421 4.19e-34

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 131.25  E-value: 4.19e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    186 DIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAA 265
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    266 ATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLA-------KLTEEGIRGVNAQA 338
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAersaesaKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    339 HAIGQATDETVAMV--------------EEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSV 404
Cdd:smart00283 161 NEAVAAMEESSSEVeegvelveetgdalEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250
                   ....*....|....*..
gi 82946457    405 LNQAERTGATAQRVNEL 421
Cdd:smart00283 241 SAAAEELSGLAEELDEL 257
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
136-433 5.37e-30

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 122.02  E-value: 5.37e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 136 EMAAAVLRAAFLDMDLAIsTYIEHGEAGKMKRemlALSDTVDReVALTVGDIEKQVKRLIEGACELTGVASELKTMAEAV 215
Cdd:COG0840  90 DLLEVVERIAAGDLTKRI-DESSNDEFGQLAK---SFNEMILN-LRQIIDAVQDNAEALSGASEEIAASATELSARADQQ 164
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 216 AEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEG-----------LKDATGRIRDVVRL 284
Cdd:COG0840 165 AESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEiaeelaevvkkLSESSQEIEEITSV 244
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 285 IQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLAKLTEEGIRGVNAQAHAIGQAT--------------DETVA 350
Cdd:COG0840 245 INSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAadavehmeesasevSEGVK 324
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 351 MVEEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSVLNQAERTGATAQRVNELSVVVNRDVG 430
Cdd:COG0840 325 LVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVA 404

                ...
gi 82946457 431 DLQ 433
Cdd:COG0840 405 KFK 407
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
254-425 8.23e-23

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 97.52  E-value: 8.23e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457   254 TDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVKRLAKLTEEGirg 333
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQA--- 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457   334 vnaqAHAIGQATDETVAMVEEVTASIQDINaiaQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSVLNQAERTGA 413
Cdd:pfam00015  95 ----AKEIEALIEEIVKQTNDSTASIQQTR---TEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQ 167
                         170
                  ....*....|..
gi 82946457   414 TAQRVNELSVVV 425
Cdd:pfam00015 168 VNQAVARIDQVT 179
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
197-425 2.44e-18

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 87.43  E-value: 2.44e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  197 GACELTGVASELKTMAEAVAEAV-------------------------SVTSDNVQSVAGASEALEETSRQISAKVHGTS 251
Cdd:PRK09793 241 GRNEITAIFASLKTMQQALRGTVsdvrkgsqemhigiaeivagnndlsSRTEQQAASLAQTAASMEQLTATVGQNADNAR 320
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  252 QLTDAAQQKMETA----------AATVEGLKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVK 321
Cdd:PRK09793 321 QASELAKNAATTAqaggvqvstmTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVR 400
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  322 RLAK-----------LTEEGIRGVnaqaHAIGQATDETVAMVEEVTASIQDINAIAQEVNLSSEMQLSATADIKGNAGQA 390
Cdd:PRK09793 401 NLASrsaqaakeikgLIEESVNRV----QQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQM 476
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 82946457  391 AQHTgtvHGHALSVLNQAERTGATAQRVNELSVVV 425
Cdd:PRK09793 477 DQVT---QQNASLVEEAAVATEQLANQADHLSSRV 508
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
168-368 3.98e-18

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 86.93  E-value: 3.98e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  168 EMLALSDTVDR---EVALTVGDIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVTSDNVQSVAGASEALEETSRQIS 244
Cdd:PRK15041 248 EMGQLAESLRHmqgELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQAS 327
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  245 akvHGTSQLTDAAQQKMETAAATVEGLKDATG---RIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAVVADEVK 321
Cdd:PRK15041 328 ---HLALSASETAQRGGKVVDNVVQTMRDISTssqKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVR 404
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 82946457  322 RLAK-----------LTEEGIRGVNAQA---HAIGQATDETVAMVEEVTASIQDINAIAQE 368
Cdd:PRK15041 405 NLAQrsaqaareiksLIEDSVGKVDVGStlvESAGETMAEIVSAVTRVTDIMGEIASASDE 465
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
166-375 5.20e-18

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 86.60  E-value: 5.20e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  166 KREMLALSDTVD---REVALTVGDIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVTsdnvqsvAGASEALEETSRQ 242
Cdd:PRK15048 244 RSEMGDLAQSVShmqRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEET-------AASMEQLTATVKQ 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  243 ISAKVHGTSQLTDAAQQKMETAAATVEG-------LKDATGRIRDVVRLIQSIAGQTRMLALNATIEAARAGDMGKGFAV 315
Cdd:PRK15048 317 NADNARQASQLAQSASDTAQHGGKVVDGvvktmheIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAV 396
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 82946457  316 VADEVKRLAKLTEEGIRGVNAQAHAIGQATDETVAMVEEVTASIQDI-NAIAQEVNLSSEM 375
Cdd:PRK15048 397 VAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIvNAVTRVTDIMGEI 457
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
151-282 1.78e-04

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 42.05  E-value: 1.78e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457   151 LAISTYIEHGEAGKMKREMLALSDTVdREVALTVGDIEKQVKRLIEGACELTG-------------------VASELKTM 211
Cdd:pfam00015  59 LALNAAIEAARAGEQGRGFAVVADEV-RKLAERSAQAAKEIEALIEEIVKQTNdstasiqqtrtevevgstiVESTGEAL 137
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 82946457   212 AEaVAEAVSVTSDNVQSVAGASEALEETSRQISAKVHGTSQLTDAAQQKMETAAATVEGLKDATGRIRDVV 282
Cdd:pfam00015 138 KE-IVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASV 207
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
167-283 2.29e-03

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 39.19  E-value: 2.29e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457    167 REMLALSDTVDREVALTVGDIEKQVKRLIEGACELTGVASELKTMAEAVAEAVSVtsdnVQSVAGASEALEETSRQISAK 246
Cdd:smart00283 147 KEIESLIKEIQEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADL----VQEIAAATDEQAAGSEEVNAA 222
                           90       100       110
                   ....*....|....*....|....*....|....*..
gi 82946457    247 VHGTSQLTDAAQQKMETAAATVEGLKDATGRIRDVVR 283
Cdd:smart00283 223 IDEIAQVTQETAAMSEEISAAAEELSGLAEELDELVE 259
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
145-318 7.55e-03

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 38.01  E-value: 7.55e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  145 AFLDMDLAISTYIEHGEAGKMKREMLALSDTVdREVALTVGDIEKQVKRLIEGACELTGVASEL-----KTMAEAVAeAV 219
Cdd:PRK15041 372 AFQTNILALNAAVEAARAGEQGRGFAVVAGEV-RNLAQRSAQAAREIKSLIEDSVGKVDVGSTLvesagETMAEIVS-AV 449
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457  220 SVTSDNVQSVAGASealEETSRQISAKVHGTSQLTDAAQQK---METAAATVEGLKDATGRIRDVVRLIQSIAGQTRMLA 296
Cdd:PRK15041 450 TRVTDIMGEIASAS---DEQSRGIDQVGLAVAEMDRVTQQNaalVEESAAAAAALEEQASRLTEAVAVFRIQQQQQQQRE 526
                        170       180
                 ....*....|....*....|..
gi 82946457  297 LNATIEAARAGDMGKgfAVVAD 318
Cdd:PRK15041 527 TSAVVKTVTPATPRK--MAVAD 546
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
210-439 8.22e-03

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 37.66  E-value: 8.22e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 210 TMAEAVAEAVSVTSDNVQSVAGASEALEETSRQISAkvhgTSQLTDAAQQKMETAAATVEGLKDATGRIRDVVRLIQSI- 288
Cdd:COG0840   4 EAPLNLELIELAAGEADAGLLKLKKLIDELGKLLLS----LNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAIl 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82946457 289 ---AGQTRMLALNATIEAARAGDMGKGFAVV-ADEVKRLAKLTEEGIRGVNAQAHAIGQATDETVAMVEEVTASIQDINA 364
Cdd:COG0840  80 llrAILEPISDLLEVVERIAAGDLTKRIDESsNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSA 159
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 82946457 365 IAQEVNLSSEMQLSATADIKGNAGQAAQHTGTVHGHALSVLNQAERTGATAQRV----NELSVVVNRDVGDLQRRLGII 439
Cdd:COG0840 160 RADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAveqmQEIAEELAEVVKKLSESSQEI 238
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH