NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|77388220|gb|ABA79405|]
View 

TlpL, putative cytoplasmic chemoreceptor [Rhodobacter sphaeroides 2.4.1]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
7-157 8.98e-40

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


:

Pssm-ID: 238516  Cd Length: 147  Bit Score: 139.32  E-value: 8.98e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   7 LDERLRFLGIGRDDA-LDDATRALLNEAVGRALDRFHERMRQTS-AAGFFADATHMDSAKSRQARHWARLASGEIDAAYV 84
Cdd:cd01068   3 LDERLAFLGLDEDDLsLLKALRPVIEANADELVDRFYDHLRRTPeTAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYI 82
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 77388220  85 EEAVRVGRTHARIGLEPRWYLGGYALILEEIVQTMLPRMAGRgffgrrraTRAAHALGYIVKVALLDMDYGVS 157
Cdd:cd01068  83 AQRVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESILSA--------DELAQALRALIKLLDLDMDLVTS 147
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
179-346 1.02e-25

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 102.31  E-value: 1.02e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 179 EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAMRLIADK-------INVLREIARQT 251
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaeigeiVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 252 DLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQLA---------------------HTTLATSEEARSG 310
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIeeiqeqteeaveameetseevEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 77388220 311 LEELVPDIRRTSTLVAEISAACREQSIGVEEINRMV 346
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAV 196
 
Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
7-157 8.98e-40

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 139.32  E-value: 8.98e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   7 LDERLRFLGIGRDDA-LDDATRALLNEAVGRALDRFHERMRQTS-AAGFFADATHMDSAKSRQARHWARLASGEIDAAYV 84
Cdd:cd01068   3 LDERLAFLGLDEDDLsLLKALRPVIEANADELVDRFYDHLRRTPeTAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYI 82
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 77388220  85 EEAVRVGRTHARIGLEPRWYLGGYALILEEIVQTMLPRMAGRgffgrrraTRAAHALGYIVKVALLDMDYGVS 157
Cdd:cd01068  83 AQRVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESILSA--------DELAQALRALIKLLDLDMDLVTS 147
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
7-162 7.53e-30

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 112.68  E-value: 7.53e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220     7 LDERLRFLGIGRDD--ALDDAtRALLNEAVGRALDRFHERMRQTS-AAGFFADATHMDSAKSRQARHWARLASGEIDAAY 83
Cdd:pfam11563   3 LEYRLRFLGLTEEDlaALRAL-RPLIEPHIPAILDRFYEKLLSHPeTARIFTDESQIERLKKTLRAYLLELFSGPYDEAY 81
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 77388220    84 VEEAVRVGRTHARIGLEPRWYLGGYALILEEIVQTMLPRMAGRgffgrrrATRAAHALGYIVKVALLDMDYGVSTYFDA 162
Cdd:pfam11563  82 VEYRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALLEKIRLS-------AAELTALVRALSKLINLDQDLVLSAYEEE 153
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
179-346 1.02e-25

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 102.31  E-value: 1.02e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 179 EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAMRLIADK-------INVLREIARQT 251
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaeigeiVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 252 DLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQLA---------------------HTTLATSEEARSG 310
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIeeiqeqteeaveameetseevEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 77388220 311 LEELVPDIRRTSTLVAEISAACREQSIGVEEINRMV 346
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAV 196
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
175-365 2.50e-30

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 117.00  E-value: 2.50e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220    175 REVAEEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAM-------------------- 234
Cdd:smart00283  10 AAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMdqirevveeavsaveelees 89
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220    235 -RLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQL----------------- 296
Cdd:smart00283  90 sDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLikeiqeetneavaamee 169
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 77388220    297 ----AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEINRMVLRLSELSRRIDSRSDRSEA 365
Cdd:smart00283 170 ssseVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISA 242
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
161-354 1.10e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 110.10  E-value: 1.10e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  161 DAVQSEREELVKGDREVA---EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVE-------RS 230
Cdd:PRK15048 273 DAIYAGTREIAAGNTDLSsrtEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDgvvktmhEI 352
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  231 ADAMRLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQL-------AHTTLAT 303
Cdd:PRK15048 353 ADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALiedsvsrVDTGSVL 432
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 77388220  304 SEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEInrmVLRLSELSR 354
Cdd:PRK15048 433 VESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQV---ALAVSEMDR 480
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
149-354 2.91e-24

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 101.22  E-value: 2.91e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 149 LLDMDYGVSTYFDAVQSEREELVKGDREV---AEEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGA 225
Cdd:COG0840 129 LRQIIDAVQDNAEALSGASEEIAASATELsarADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGE 208
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 226 AVERSADAM------------------RLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAA 287
Cdd:COG0840 209 EVRQAVEQMqeiaeelaevvkklsessQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSA 288
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 288 AASHEIDQL---------------------AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEINRMV 346
Cdd:COG0840 289 DSAKEIGLLieeiqneaadavehmeesaseVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASI 368

                ....*...
gi 77388220 347 LRLSELSR 354
Cdd:COG0840 369 EELDDVTQ 376
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
206-365 6.90e-22

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 91.74  E-value: 6.90e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   206 ASETEQLAAQNARAAET-GGAAVERSADAMRLIADK-------INVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAA 277
Cdd:pfam00015   3 ASDLAQLASEEALDEMSqIGQVVDDAVETMEELETSskkisdiISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVAD 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   278 EVRKLAEHAAAASHEIDQL---------------------AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQS 336
Cdd:pfam00015  83 EVRKLAERSAQAAKEIEALieeivkqtndstasiqqtrteVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQS 162
                         170       180
                  ....*....|....*....|....*....
gi 77388220   337 IGVEEINRMVLRLSELSRRIDSRSDRSEA 365
Cdd:pfam00015 163 AGIDQVNQAVARIDQVTQQNAALVEESAA 191
 
Name Accession Description Interval E-value
sensor_globin cd01068
Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in ...
7-157 8.98e-40

Globin domain present in Globin-Coupled-Sensors (GCS). These domains detect changes in intracellular concentrations of oxygen, carbon monoxyde, or nitrous oxide, which result in aerotaxis and/or gene regulation. One subgroup, the HemATs, are aerotactic heme sensors combining a globin with an MCP signaling domain, others function as gene regulators, by direct combination with DNA-binding domains, with domains modulating 2nd messengers, or with domains interacting with transcription factors or regulators.


Pssm-ID: 238516  Cd Length: 147  Bit Score: 139.32  E-value: 8.98e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   7 LDERLRFLGIGRDDA-LDDATRALLNEAVGRALDRFHERMRQTS-AAGFFADATHMDSAKSRQARHWARLASGEIDAAYV 84
Cdd:cd01068   3 LDERLAFLGLDEDDLsLLKALRPVIEANADELVDRFYDHLRRTPeTAAFLGDESVVERLKSTQRRHWVELFSGVYDEAYI 82
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 77388220  85 EEAVRVGRTHARIGLEPRWYLGGYALILEEIVQTMLPRMAGRgffgrrraTRAAHALGYIVKVALLDMDYGVS 157
Cdd:cd01068  83 AQRVRIGEVHARIGLEPKWYLGGYAVLLELLIGALRESILSA--------DELAQALRALIKLLDLDMDLVTS 147
Protoglobin pfam11563
Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also ...
7-162 7.53e-30

Protoglobin; This family includes protoglobin from Methanosarcina acetivorans C2A. It is also found near the N-terminus of the Haem-based aerotactic transducer HemAT in Bacillus subtilis. It is part of the haemoglobin superfamily. Protoglobin has specific loops and an amino-terminal extension which leads to the burying of the haem within the matrix of the protein. Protoglobin-specific apolar tunnels allow the access of O2, CO and NO to the haem distal site. In HemAT it acts as an oxygen sensor domain.


Pssm-ID: 256506  Cd Length: 156  Bit Score: 112.68  E-value: 7.53e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220     7 LDERLRFLGIGRDD--ALDDAtRALLNEAVGRALDRFHERMRQTS-AAGFFADATHMDSAKSRQARHWARLASGEIDAAY 83
Cdd:pfam11563   3 LEYRLRFLGLTEEDlaALRAL-RPLIEPHIPAILDRFYEKLLSHPeTARIFTDESQIERLKKTLRAYLLELFSGPYDEAY 81
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 77388220    84 VEEAVRVGRTHARIGLEPRWYLGGYALILEEIVQTMLPRMAGRgffgrrrATRAAHALGYIVKVALLDMDYGVSTYFDA 162
Cdd:pfam11563  82 VEYRLRIGLVHVRIGLEPRWYIAAYAVVLESLLEALLEKIRLS-------AAELTALVRALSKLINLDQDLVLSAYEEE 153
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
179-346 1.02e-25

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 102.31  E-value: 1.02e-25
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 179 EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAMRLIADK-------INVLREIARQT 251
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESsaeigeiVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 252 DLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQLA---------------------HTTLATSEEARSG 310
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIeeiqeqteeaveameetseevEEGVELVEETGRA 160
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 77388220 311 LEELVPDIRRTSTLVAEISAACREQSIGVEEINRMV 346
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAV 196
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
175-365 2.50e-30

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 117.00  E-value: 2.50e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220    175 REVAEEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAM-------------------- 234
Cdd:smart00283  10 AAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMdqirevveeavsaveelees 89
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220    235 -RLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQL----------------- 296
Cdd:smart00283  90 sDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLikeiqeetneavaamee 169
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 77388220    297 ----AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEINRMVLRLSELSRRIDSRSDRSEA 365
Cdd:smart00283 170 ssseVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISA 242
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
161-354 1.10e-26

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 110.10  E-value: 1.10e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  161 DAVQSEREELVKGDREVA---EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVE-------RS 230
Cdd:PRK15048 273 DAIYAGTREIAAGNTDLSsrtEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDgvvktmhEI 352
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  231 ADAMRLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQL-------AHTTLAT 303
Cdd:PRK15048 353 ADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALiedsvsrVDTGSVL 432
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 77388220  304 SEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEInrmVLRLSELSR 354
Cdd:PRK15048 433 VESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQV---ALAVSEMDR 480
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
161-365 2.21e-26

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 109.27  E-value: 2.21e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  161 DAVQSEREELVKGDREVA---EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAMR-- 235
Cdd:PRK15041 275 NAIYSGASEIATGNNDLSsrtEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRdi 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  236 -----LIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQLAHTTLAT------- 303
Cdd:PRK15041 355 stssqKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKvdvgstl 434
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 77388220  304 SEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEINRMVLRLSELSRRIDSRSDRSEA 365
Cdd:PRK15041 435 VESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAA 496
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
169-355 2.97e-26

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 108.62  E-value: 2.97e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  169 ELVKGDREVA---EEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGAAVERSADAMRLIA------- 238
Cdd:PRK09793 279 EIVAGNNDLSsrtEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIAtssqkig 358
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220  239 DKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAAAASHEIDQLAHTTLATSEE-------ARSGL 311
Cdd:PRK09793 359 DIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQgsklvnnAAATM 438
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 77388220  312 EELVPDIRRTSTLVAEISAACREQSIGVEEINRMVLRLSELSRR 355
Cdd:PRK09793 439 TDIVSSVTRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQ 482
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
149-354 2.91e-24

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 101.22  E-value: 2.91e-24
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 149 LLDMDYGVSTYFDAVQSEREELVKGDREV---AEEIARALVGASSAMEEVTGTIRHTAGNASETEQLAAQNARAAETGGA 225
Cdd:COG0840 129 LRQIIDAVQDNAEALSGASEEIAASATELsarADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGE 208
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 226 AVERSADAM------------------RLIADKINVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAAEVRKLAEHAA 287
Cdd:COG0840 209 EVRQAVEQMqeiaeelaevvkklsessQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSA 288
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220 288 AASHEIDQL---------------------AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQSIGVEEINRMV 346
Cdd:COG0840 289 DSAKEIGLLieeiqneaadavehmeesaseVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASI 368

                ....*...
gi 77388220 347 LRLSELSR 354
Cdd:COG0840 369 EELDDVTQ 376
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
206-365 6.90e-22

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 91.74  E-value: 6.90e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   206 ASETEQLAAQNARAAET-GGAAVERSADAMRLIADK-------INVLREIARQTDLLALNAAVEAARAGQHGAGFSVVAA 277
Cdd:pfam00015   3 ASDLAQLASEEALDEMSqIGQVVDDAVETMEELETSskkisdiISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVAD 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77388220   278 EVRKLAEHAAAASHEIDQL---------------------AHTTLATSEEARSGLEELVPDIRRTSTLVAEISAACREQS 336
Cdd:pfam00015  83 EVRKLAERSAQAAKEIEALieeivkqtndstasiqqtrteVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQS 162
                         170       180
                  ....*....|....*....|....*....
gi 77388220   337 IGVEEINRMVLRLSELSRRIDSRSDRSEA 365
Cdd:pfam00015 163 AGIDQVNQAVARIDQVTQQNAALVEESAA 191
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH