NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|76802246|ref|YP_327254|]
View 

transducer protein htr31 [Natronomonas pharaonis DSM 2160]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
440-639 6.22e-48

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 167.80  E-value: 6.22e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 440 ESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQT 519
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 520 NILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSA 599
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 76802246 600 LDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVR 639
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
375-469 2.66e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 38.37  E-value: 2.66e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 375 VEDELLDVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSN 454
Cdd:cd11386 104 VADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQ 183
                        90
                ....*....|....*
gi 76802246 455 EVATAAESALDNAER 469
Cdd:cd11386 184 EQSASTQEIAAAVEE 198
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
608-675 5.22e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 37.60  E-value: 5.22e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246 608 EDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLST 675
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGE 68
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
415-674 2.15e-56

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 193.66  E-value: 2.15e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    415 TDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDS 494
Cdd:smart00283   3 SEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSA 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    495 VAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDT 574
Cdd:smart00283  83 VEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETNE 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    575 TVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVE 654
Cdd:smart00283 163 AVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISA 242
                          250       260
                   ....*....|....*....|
gi 76802246    655 EAETQEAAVGTLSERVERLS 674
Cdd:smart00283 243 AAEELSGLAEELDELVERFK 262
PAS_9 pfam13426
PAS domain;
204-335 3.59e-07

PAS domain;


:

Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 48.92  E-value: 3.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   204 PYGVFLIDDENTMLGYNTAINRLLGLDADhrEFLGRDCRETLAAAtytDNSRHHALADKVVDAPRNADEEWDVERREdtf 283
Cdd:pfam13426   1 PDGILVLDPEGRIVYANPAALRLLGYTRE--ELLGKSIRDLFGPG---TDEEAVARLREALRNGGEVEVELELRRKD--- 72
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 76802246   284 sfignddivygdtsvsvnteGEETHIDFLAAPIFDDDGELRAVIELVEDRSE 335
Cdd:pfam13426  73 --------------------GEPFPVLVSASPVRDEDGEVVGIVGILRDITE 104
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
440-639 6.22e-48

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 167.80  E-value: 6.22e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 440 ESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQT 519
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 520 NILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSA 599
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 76802246 600 LDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVR 639
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
375-469 2.66e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 38.37  E-value: 2.66e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 375 VEDELLDVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSN 454
Cdd:cd11386 104 VADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQ 183
                        90
                ....*....|....*
gi 76802246 455 EVATAAESALDNAER 469
Cdd:cd11386 184 EQSASTQEIAAAVEE 198
Laminin_II pfam06009
Laminin Domain II; It has been suggested that the domains I and II from laminin A, B1 and B2 ...
544-646 3.15e-03

Laminin Domain II; It has been suggested that the domains I and II from laminin A, B1 and B2 may come together to form a triple helical coiled-coil structure.


Pssm-ID: 253508  Cd Length: 138  Bit Score: 37.08  E-value: 3.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   544 ADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREeideSLSALDELSESIEDAAEGIQEVAEANDE 623
Cdd:pfam06009  12 AKEVLEQLAPLSQNLENTSEKLSGINGSLEETNELVNDANKALDDAGR----SVKKLEKLAPDLLDKLKPLKQLEVNSSS 87
                          90       100
                  ....*....|....*....|...
gi 76802246   624 QAATVEEVTATVDEVREQAHEVK 646
Cdd:pfam06009  88 LSDNISRIKELIAQARKAANSIK 110
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
608-675 5.22e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 37.60  E-value: 5.22e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246 608 EDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLST 675
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGE 68
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
415-674 2.15e-56

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 193.66  E-value: 2.15e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    415 TDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDS 494
Cdd:smart00283   3 SEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSA 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    495 VAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDT 574
Cdd:smart00283  83 VEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETNE 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    575 TVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVE 654
Cdd:smart00283 163 AVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISA 242
                          250       260
                   ....*....|....*....|
gi 76802246    655 EAETQEAAVGTLSERVERLS 674
Cdd:smart00283 243 AAEELSGLAEELDELVERFK 262
PAS_9 pfam13426
PAS domain;
204-335 3.59e-07

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 48.92  E-value: 3.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   204 PYGVFLIDDENTMLGYNTAINRLLGLDADhrEFLGRDCRETLAAAtytDNSRHHALADKVVDAPRNADEEWDVERREdtf 283
Cdd:pfam13426   1 PDGILVLDPEGRIVYANPAALRLLGYTRE--ELLGKSIRDLFGPG---TDEEAVARLREALRNGGEVEVELELRRKD--- 72
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 76802246   284 sfignddivygdtsvsvnteGEETHIDFLAAPIFDDDGELRAVIELVEDRSE 335
Cdd:pfam13426  73 --------------------GEPFPVLVSASPVRDEDGEVVGIVGILRDITE 104
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
322-673 5.02e-54

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 191.74  E-value: 5.02e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 322 ELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVE 401
Cdd:COG0840  63 LISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQ-----LAKSFNEMILNLRQIIDAVQ 137
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 402 DQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAkavT 481
Cdd:COG0840 138 DNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQA---V 214
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 482 DEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEI 561
Cdd:COG0840 215 EQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEI 294
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 562 RDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQ 641
Cdd:COG0840 295 GLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
                       330       340       350
                ....*....|....*....|....*....|..
gi 76802246 642 AHEVKQETNDIVEEAETQEAAVGTLSERVERL 673
Cdd:COG0840 375 TQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
467-673 1.37e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 122.55  E-value: 1.37e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   467 AERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADE 546
Cdd:pfam00015   4 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   547 VKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAA 626
Cdd:pfam00015  84 VRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 76802246   627 TVEEVTATVDEVReqahEVKQETNDIVEEAetqEAAVGTLSERVERL 673
Cdd:pfam00015 164 GIDQVNQAVARID----QVTQQNAALVEES---AAAAETLEEQAEEL 203
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
357-681 3.06e-25

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 109.33  E-value: 3.06e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  357 IGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVS 436
Cdd:PRK15048 230 IAGGNLANTLTIDGRSEMGD-----LAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETA 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  437 NELESFSATMEEVAASSNEVATAAESALDNAERGvdsgqdaKAVTDEVnelseqlVDSVAELDEYMAEIGEVVDIIADVA 516
Cdd:PRK15048 305 ASMEQLTATVKQNADNARQASQLAQSASDTAQHG-------GKVVDGV-------VKTMHEIADSSKKIADIISVIDGIA 370
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  517 DQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIRE-------V 589
Cdd:PRK15048 371 FQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNivnavtrV 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  590 REEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDI-----VEEAETQEAAVG 664
Cdd:PRK15048 451 TDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFrlaasPLTNKPQTPSRP 530
                        330
                 ....*....|....*..
gi 76802246  665 TLSERVERLSTDATEND 681
Cdd:PRK15048 531 ASEQPPAQPRLRIAEQD 547
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
330-670 1.31e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 73.17  E-value: 1.31e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    330 VEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVE--DELLDVVEAVNGMAENFEQL---VIRVEDQT 404
Cdd:TIGR02168  628 VDDLDNALELAKKLRPGYRIVTLDGDLVRPGGVITGGSAKTNSSILErrREIEELEEKIEELEEKIAELekaLAELRKEL 707
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    405 EALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVAtaaesaldnaergvdsgqdakavtDEV 484
Cdd:TIGR02168  708 EELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELE------------------------AEI 763
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    485 NELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETqqytDEIRDR 564
Cdd:TIGR02168  764 EELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRI----AATERR 839
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    565 IETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHE 644
Cdd:TIGR02168  840 LEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEE 919
                          330       340
                   ....*....|....*....|....*.
gi 76802246    645 VKQETNDIVEEAETQEAAVGTLSERV 670
Cdd:TIGR02168  920 LREKLAQLELRLEGLEVRIDNLQERL 945
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
433-655 7.95e-04

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 41.31  E-value: 7.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   433 EEVSNELESFSATMEEvAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDII 512
Cdd:PTZ00341  926 KELKNQNENVPEHLKE-HAEANIEEDAEENVEEDAEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENIE 1004
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   513 ADVADQtnilaLNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDriETVQGQTDTTVEEVERTNdhIREVREE 592
Cdd:PTZ00341 1005 ENVEEN-----VEENIEENVEEYDEENVEEVEENVEEYDEENVEEIEENAE--ENVEENIEENIEEYDEEN--VEEIEEN 1075
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 76802246   593 IDESLSalDELSESIEDAAEGIQEVAEANDEQAATvEEVTATVDE-VREQAHEVKQETNDIVEE 655
Cdd:PTZ00341 1076 IEENIE--ENVEENVEENVEEIEENVEENVEENAE-ENAEENAEEnAEEYDDENPEEHNEEYDE 1136
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
320-503 1.35e-03

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 39.35  E-value: 1.35e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   320 DGELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIG--TGELS-------SRADFDGDD-ELVEDELLDVVEAVNGM 389
Cdd:pfam00015  15 LDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAfqTNLLAlnaaieaARAGEQGRGfAVVADEVRKLAERSAQA 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   390 AENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAER 469
Cdd:pfam00015  95 AKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVAR 174
                         170       180       190
                  ....*....|....*....|....*....|....
gi 76802246   470 GVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMA 503
Cdd:pfam00015 175 IDQVTQQNAALVEESAAAAETLEEQAEELTASVA 208
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
440-639 6.22e-48

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 167.80  E-value: 6.22e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 440 ESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQT 519
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 520 NILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSA 599
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRA 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|
gi 76802246 600 LDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVR 639
Cdd:cd11386 161 FEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
375-469 2.66e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 38.37  E-value: 2.66e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 375 VEDELLDVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSN 454
Cdd:cd11386 104 VADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFEEIVASVEEVADGIQEISAATQ 183
                        90
                ....*....|....*
gi 76802246 455 EVATAAESALDNAER 469
Cdd:cd11386 184 EQSASTQEIAAAVEE 198
Laminin_II pfam06009
Laminin Domain II; It has been suggested that the domains I and II from laminin A, B1 and B2 ...
544-646 3.15e-03

Laminin Domain II; It has been suggested that the domains I and II from laminin A, B1 and B2 may come together to form a triple helical coiled-coil structure.


Pssm-ID: 253508  Cd Length: 138  Bit Score: 37.08  E-value: 3.15e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   544 ADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREeideSLSALDELSESIEDAAEGIQEVAEANDE 623
Cdd:pfam06009  12 AKEVLEQLAPLSQNLENTSEKLSGINGSLEETNELVNDANKALDDAGR----SVKKLEKLAPDLLDKLKPLKQLEVNSSS 87
                          90       100
                  ....*....|....*....|...
gi 76802246   624 QAATVEEVTATVDEVREQAHEVK 646
Cdd:pfam06009  88 LSDNISRIKELIAQARKAANSIK 110
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
608-675 5.22e-03

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 37.60  E-value: 5.22e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246 608 EDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLST 675
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGE 68
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
415-674 2.15e-56

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 193.66  E-value: 2.15e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    415 TDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDS 494
Cdd:smart00283   3 SEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSA 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    495 VAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDT 574
Cdd:smart00283  83 VEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETNE 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    575 TVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVE 654
Cdd:smart00283 163 AVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEISA 242
                          250       260
                   ....*....|....*....|
gi 76802246    655 EAETQEAAVGTLSERVERLS 674
Cdd:smart00283 243 AAEELSGLAEELDELVERFK 262
PAS_9 pfam13426
PAS domain;
204-335 3.59e-07

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 48.92  E-value: 3.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   204 PYGVFLIDDENTMLGYNTAINRLLGLDADhrEFLGRDCRETLAAAtytDNSRHHALADKVVDAPRNADEEWDVERREdtf 283
Cdd:pfam13426   1 PDGILVLDPEGRIVYANPAALRLLGYTRE--ELLGKSIRDLFGPG---TDEEAVARLREALRNGGEVEVELELRRKD--- 72
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 76802246   284 sfignddivygdtsvsvnteGEETHIDFLAAPIFDDDGELRAVIELVEDRSE 335
Cdd:pfam13426  73 --------------------GEPFPVLVSASPVRDEDGEVVGIVGILRDITE 104
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
322-673 5.02e-54

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 191.74  E-value: 5.02e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 322 ELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVE 401
Cdd:COG0840  63 LISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQ-----LAKSFNEMILNLRQIIDAVQ 137
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 402 DQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAkavT 481
Cdd:COG0840 138 DNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQA---V 214
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 482 DEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEI 561
Cdd:COG0840 215 EQMQEIAEELAEVVKKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSADSAKEI 294
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 562 RDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQ 641
Cdd:COG0840 295 GLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDV 374
                       330       340       350
                ....*....|....*....|....*....|..
gi 76802246 642 AHEVKQETNDIVEEAETQEAAVGTLSERVERL 673
Cdd:COG0840 375 TQENAAAVEELAAASEELKELAEKLLELVAKF 406
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
467-673 1.37e-31

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 122.55  E-value: 1.37e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   467 AERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADE 546
Cdd:pfam00015   4 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   547 VKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAA 626
Cdd:pfam00015  84 VRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 76802246   627 TVEEVTATVDEVReqahEVKQETNDIVEEAetqEAAVGTLSERVERL 673
Cdd:pfam00015 164 GIDQVNQAVARID----QVTQQNAALVEES---AAAAETLEEQAEEL 203
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
357-681 3.06e-25

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 109.33  E-value: 3.06e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  357 IGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVS 436
Cdd:PRK15048 230 IAGGNLANTLTIDGRSEMGD-----LAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETA 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  437 NELESFSATMEEVAASSNEVATAAESALDNAERGvdsgqdaKAVTDEVnelseqlVDSVAELDEYMAEIGEVVDIIADVA 516
Cdd:PRK15048 305 ASMEQLTATVKQNADNARQASQLAQSASDTAQHG-------GKVVDGV-------VKTMHEIADSSKKIADIISVIDGIA 370
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  517 DQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIRE-------V 589
Cdd:PRK15048 371 FQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNivnavtrV 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  590 REEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDI-----VEEAETQEAAVG 664
Cdd:PRK15048 451 TDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFrlaasPLTNKPQTPSRP 530
                        330
                 ....*....|....*..
gi 76802246  665 TLSERVERLSTDATEND 681
Cdd:PRK15048 531 ASEQPPAQPRLRIAEQD 547
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
347-647 4.86e-25

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 108.50  E-value: 4.86e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  347 VTEVTDTLDSIGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVE 426
Cdd:PRK15041 222 MNRLIDSIRHIAGGDLVKPIEVDGSNEMGQ-----LAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTE 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  427 DQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGvdsgqdaKAVTDEVnelseqlVDSVAELDEYMAEIG 506
Cdd:PRK15041 297 QQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRG-------GKVVDNV-------VQTMRDISTSSQKIA 362
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  507 EVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTD---TTVEEVERTN 583
Cdd:PRK15041 363 DIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDvgsTLVESAGETM 442
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246  584 DHI----REVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQ 647
Cdd:PRK15041 443 AEIvsavTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTE 510
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
354-663 3.18e-24

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 105.92  E-value: 3.18e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  354 LDSIGTGELSSRADFDGDDELVEdelldVVEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLE 433
Cdd:PRK09793 225 FDSIAAGNLARPIAVYGRNEITA-----IFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLA 299
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  434 EVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQlvdsvaeldeymaeIGEVVDIIA 513
Cdd:PRK09793 300 QTAASMEQLTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQK--------------IGDIISVID 365
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  514 DVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIR-------DRIETVQGQTDTTVEEVERTNDHI 586
Cdd:PRK09793 366 GIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKglieesvNRVQQGSKLVNNAAATMTDIVSSV 445
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  587 REVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAH---------EVKQETNDIVEEAE 657
Cdd:PRK09793 446 TRVNDIMGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADhlssrvavfTLEEHEVARHESAQ 525

                 ....*.
gi 76802246  658 TQEAAV 663
Cdd:PRK09793 526 LQIAPV 531
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
330-670 1.31e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 73.17  E-value: 1.31e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    330 VEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVE--DELLDVVEAVNGMAENFEQL---VIRVEDQT 404
Cdd:TIGR02168  628 VDDLDNALELAKKLRPGYRIVTLDGDLVRPGGVITGGSAKTNSSILErrREIEELEEKIEELEEKIAELekaLAELRKEL 707
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    405 EALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVAtaaesaldnaergvdsgqdakavtDEV 484
Cdd:TIGR02168  708 EELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELE------------------------AEI 763
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    485 NELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETqqytDEIRDR 564
Cdd:TIGR02168  764 EELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRI----AATERR 839
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    565 IETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHE 644
Cdd:TIGR02168  840 LEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEE 919
                          330       340
                   ....*....|....*....|....*.
gi 76802246    645 VKQETNDIVEEAETQEAAVGTLSERV 670
Cdd:TIGR02168  920 LREKLAQLELRLEGLEVRIDNLQERL 945
PRK02224 PRK02224
chromosome segregation protein; Provisional
295-681 4.71e-11

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 64.68  E-value: 4.71e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  295 DTSVSVNTEGEET--HIDFLAAPIFDDDGELRAVIELVEDRSEAVREQKE-LNGLVTEVTDTLDSIGTGELSS------R 365
Cdd:PRK02224 237 DEADEVLEEHEERreELETLEAEIEDLRETIAETEREREELAEEVRDLRErLEELEEERDDLLAEAGLDDADAeavearR 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  366 ADFDGDDELVEDELLDV---VEAVNGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESF 442
Cdd:PRK02224 317 EELEDRDEELRDRLEECrvaAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEEL 396
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  443 SATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNEL---SEQLVDS---------------VAELDEYMAE 504
Cdd:PRK02224 397 RERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERveeAEALLEAgkcpecgqpvegsphVETIEEDRER 476
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  505 IGEVVDIIADVADQTNilALNANIEAArvdadgdgfgvvadevKSLAnETQQYTDEIRDRIETVQGQTDTTVEEVERTND 584
Cdd:PRK02224 477 VEELEAELEDLEEEVE--EVEERLERA----------------EDLV-EAEDRIERLEERREDLEELIAERRETIEEKRE 537
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  585 HIREVREEIDEslsaldelsesIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVG 664
Cdd:PRK02224 538 RAEELRERAAE-----------LEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIESLERIRTLLAAIADAED 606
                        410
                 ....*....|....*..
gi 76802246  665 TLSERVERLSTDATEND 681
Cdd:PRK02224 607 EIERLREKREALAELND 623
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
421-679 5.13e-10

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 61.65  E-value: 5.13e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  421 IDRQVEDQTESLEEVSNELESFSAtmeEVAASSNEVAtAAESALDNAERGVDS-GQDAKAVTDEVNELSEQLVDSVAELD 499
Cdd:COG1196  672 LEEELAELEAQLEKLEEELKSLKN---ELRSLEDLLE-ELRRQLEELERQLEElKRELAALEEELEQLQSRLEELEEELE 747
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  500 EYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQY---TDEIRDRIETVQGQTDTTV 576
Cdd:COG1196  748 ELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAerrLDALERELESLEQRRERLE 827
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  577 EEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEA 656
Cdd:COG1196  828 QEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEI 907
                        250       260
                 ....*....|....*....|...
gi 76802246  657 ETQEAAVGTLSERVERLSTDATE 679
Cdd:COG1196  908 EKLRERLEELEAKLERLEVELPE 930
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
433-673 9.41e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 57.37  E-value: 9.41e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    433 EEVSNELESFSATMEEVAASSNEVataaESALDNAERGVDSGQDAKAVTDEVNELSEQLvdSVAELDEYMAEIGEVVDII 512
Cdd:TIGR02168  175 KETERKLERTRENLDRLEDILNEL----ERQLKSLERQAEKAERYKELKAELRELELAL--LVLRLEELREELEELQEEL 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    513 ADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRD---RIETVQGQTDTTVEEVERTNDHIREV 589
Cdd:TIGR02168  249 KEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRleqQKQILRERLANLERQLEELEAQLEEL 328
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    590 REEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSER 669
Cdd:TIGR02168  329 ESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEAR 408

                   ....
gi 76802246    670 VERL 673
Cdd:TIGR02168  409 LERL 412
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
391-672 4.64e-08

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 55.11  E-value: 4.64e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  391 ENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERG 470
Cdd:COG1196  670 KELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEEL 749
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  471 VDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSL 550
Cdd:COG1196  750 EEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQE 829
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  551 ANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEE 630
Cdd:COG1196  830 IEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEK 909
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 76802246  631 VTATVDEVREQAHEVKQETNDIVEEAETQEAAvgTLSERVER 672
Cdd:COG1196  910 LRERLEELEAKLERLEVELPELEEELEEEYED--TLETELER 949
SbcC COG0419
ATPase involved in DNA repair [DNA replication, recombination, and repair]
341-661 6.62e-08

ATPase involved in DNA repair [DNA replication, recombination, and repair]


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 54.77  E-value: 6.62e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 341 KELNGLVTEVTDTLDSI-GTGELSSRADFDGDDELVEDELLDVVEA-VNGMAENFEQLVIRVEDQTEALAESIARATDSA 418
Cdd:COG0419 147 AFLKSKPKERKEILDELfGLEKYEKLSELLKEVIKEAKAKIEELEGqLSELLEDIEDLLEALEEELKELKKLEEIQEEQE 226
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 419 HSIDRQ----VEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVds 494
Cdd:COG0419 227 EEELEQeieaLEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELE-- 304
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 495 vAELDEYMAEIGEVVDIIADV-ADQTNILALNANIEAARvdadgdgfgvvaDEVKSLANETQQYTDEIRDRIETVQGQTD 573
Cdd:COG0419 305 -EELEGLRALLEELEELLEKLkSLEERLEKLEEKLEKLE------------SELEELAEEKNELAKLLEERLKELEERLE 371
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 574 TTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIV 653
Cdd:COG0419 372 ELEKELEKALERLKQLEEAIQELKEELAELSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQINQLESKELMIA 451

                ....*...
gi 76802246 654 EEAETQEA 661
Cdd:COG0419 452 ELAGAGEK 459
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
324-656 1.38e-07

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 53.56  E-value: 1.38e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  324 RAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVEDELLDVVEAVNGMAENFEQLViRVEDQ 403
Cdd:COG1196  681 AQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELE-ELQER 759
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  404 TEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAK----- 478
Cdd:COG1196  760 LEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEeeiee 839
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  479 ------AVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNilALNANIEAARvdadgdgfgvvaDEVKSLAN 552
Cdd:COG1196  840 leekldELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKE--ELEEELRELE------------SELAELKE 905
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  553 ETQQYTDEIRDrIETVQGQTDTTVEEVERTN------DHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAA 626
Cdd:COG1196  906 EIEKLRERLEE-LEAKLERLEVELPELEEELeeeyedTLETELEREIERLEEEIEALGPVNLRAIEEYEEVEERYEELKS 984
                        330       340       350
                 ....*....|....*....|....*....|
gi 76802246  627 TVEEVTATVDEVREQAHEVKQETNDIVEEA 656
Cdd:COG1196  985 QREDLEEAKEKLLEVIEELDKEKRERFKET 1014
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
399-661 1.96e-07

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 53.18  E-value: 1.96e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  399 RVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDsgqdak 478
Cdd:COG1196  243 ELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELEN------ 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  479 avtdEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYT 558
Cdd:COG1196  317 ----ELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAEL 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  559 DEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEV 638
Cdd:COG1196  393 AEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAEL 472
                        250       260
                 ....*....|....*....|...
gi 76802246  639 REQAHEVKQETNDIVEEAETQEA 661
Cdd:COG1196  473 QEELQRLEKELSSLEARLDRLEA 495
PRK02224 PRK02224
chromosome segregation protein; Provisional
330-640 3.12e-07

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 52.35  E-value: 3.12e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  330 VEDRSEAVREQK-ELNGLVTEVTDTLDSIGTGELSSRADFDG------DDELVEDELLDVVEAVNGMAENFEQLVIRVED 402
Cdd:PRK02224 410 AEDFLEELREERdELREREAELEATLRTARERVEEAEALLEAgkcpecGQPVEGSPHVETIEEDRERVEELEAELEDLEE 489
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  403 QTEALAESIARATDSAhsidrQVEDQTESLEEVSNELESFSATMEEVAassNEVATAAESALDNAERGVDSGQDAKAVTD 482
Cdd:PRK02224 490 EVEEVEERLERAEDLV-----EAEDRIERLEERREDLEELIAERRETI---EEKRERAEELRERAAELEAEAEEKREAAA 561
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  483 EVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADqtnILALNANIEAA--RVDADGDGFGVVADEVKSLANETQQYTDE 560
Cdd:PRK02224 562 EAEEEAEEAREEVAELNSKLAELKERIESLERIRT---LLAAIADAEDEieRLREKREALAELNDERRERLAEKRERKRE 638
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  561 IR-----DRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDaaegIQEVAEANDEQAATVEEVTATV 635
Cdd:PRK02224 639 LEaefdeARIEEAREDKERAEEYLEQVEEKLDELREERDDLQAEIGAVENELEE----LEELRERREALENRVEALEALY 714

                 ....*
gi 76802246  636 DEVRE 640
Cdd:PRK02224 715 DEAEE 719
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
420-690 6.47e-07

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 51.64  E-value: 6.47e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  420 SIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESAldnAERGVDSGQDAKAVTDEVNELSEQLVDSVAELD 499
Cdd:COG1196  243 ELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEEL---QEELLELKEEIEELEGEISLLRERLEELENELE 319
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  500 EYMAEIGEVVDIIadVADQTNILALNANIEAARVDADgdgfgVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEV 579
Cdd:COG1196  320 ELEERLEELKEKI--EALKEELEERETLLEELEQLLA-----ELEEAKEELEEKLSALLEELEELFEALREELAELEAEL 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  580 ERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQ 659
Cdd:COG1196  393 AEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAEL 472
                        250       260       270
                 ....*....|....*....|....*....|...
gi 76802246  660 EAAVGTLSERVERLST--DATENDGDGFDETTA 690
Cdd:COG1196  473 QEELQRLEKELSSLEArlDRLEAEQRASQGVRA 505
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
586-675 1.01e-06

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 49.59  E-value: 1.01e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    586 IREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGT 665
Cdd:smart00283   6 VEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEE 85
                           90
                   ....*....|
gi 76802246    666 LSERVERLST 675
Cdd:smart00283  86 LEESSDEIGE 95
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
321-609 1.36e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 50.44  E-value: 1.36e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    321 GELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDgddeLVEDELLDVVEAVngmaENFEQLVIRV 400
Cdd:TIGR02168  765 ELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELT----LLNEEAANLRERL----ESLERRIAAT 836
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    401 EDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMeevaASSNEVATAAESALDNAERGVDS-GQDAKA 479
Cdd:TIGR02168  837 ERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNER----ASLEEALALLRSELEELSEELRElESKRSE 912
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    480 VTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVadqtnilalnanieaarvdadgdgFGVVADEVKSLANETQQYTD 559
Cdd:TIGR02168  913 LRRELEELREKLAQLELRLEGLEVRIDNLQERLSEE------------------------YSLTLEEAEALENKIEDDEE 968
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 76802246    560 EIRDRIETVQGQTD-------TTVEEVERTNDHIREVREEIDESLSALDELSESIED 609
Cdd:TIGR02168  969 EARRRLKRLENKIKelgpvnlAAIEEYEELKERYDFLTAQKEDLTEAKETLEEAIEE 1025
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
373-676 2.29e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 49.68  E-value: 2.29e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    373 ELVEDELLDVVEAVNG---MAENFEQLVIRVED--QTEALAESIARATDSAhSIDRQVEDQTESLEEVSNELESFSATME 447
Cdd:TIGR02169  190 DLIIDEKRQQLERLRRereKAERYQALLKEKREyeGYELLKEKEALERQKE-AIERQLASLEEELEKLTEEISELEKRLE 268
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    448 EVAASSNEVATAAESALDNAERGVDS------GQDAKAVtDEVNELSEQLVDSVAELDEYMAEIGEVvdiiadvadQTNI 521
Cdd:TIGR02169  269 EIEQLLEELNKKIKDLGEEEQLRVKEkigeleAEIASLE-RSIAEKERELEDAEERLAKLEAEIDKL---------LAEI 338
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    522 LALNANIEAARVDADGdgfgvVADEVKSLANETqqytDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALD 601
Cdd:TIGR02169  339 EELEREIEEERKRRDK-----LTEEYAELKEEL----EDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELD 409
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 76802246    602 ELSESIEDAAEgiqEVAEANDEQAATVEEVTATVDEVREQAHEVKQETndivEEAETQEAAVGTLSERVERLSTD 676
Cdd:TIGR02169  410 RLQEELQRLSE---ELADLNAAIAGIEAKINELEEEKEDKALEIKKQE----WKLEQLAADLSKYEQELYDLKEE 477
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
376-671 3.00e-06

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 49.33  E-value: 3.00e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  376 EDELLDVVEAVNGMAENFEQLVIRVEDqteaLAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNE 455
Cdd:COG1196  238 RKELEELEEELSRLEEELEELQEELEE----AEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEE 313
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  456 VATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADvADQTNILALNAN---IEAAR 532
Cdd:COG1196  314 LENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLE-ELEELFEALREElaeLEAEL 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  533 VDADGDgfgvvADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAE 612
Cdd:COG1196  393 AEIRNE-----LEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELER 467
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 76802246  613 GIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVE 671
Cdd:COG1196  468 ELAELQEELQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIK 526
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
443-675 3.79e-06

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 48.45  E-value: 3.79e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 443 SATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNIL 522
Cdd:COG0840   6 PLNLELIELAAGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAIL 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 523 -ALNANIEAARVDADGDGFgvvADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALD 601
Cdd:COG0840  86 ePISDLLEVVERIAAGDLT---KRIDESSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARAD 162
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246 602 ELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEE----AETQEAAVGTLSERVERLST 675
Cdd:COG0840 163 QQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQmqeiAEELAEVVKKLSESSQEIEE 240
PRK02224 PRK02224
chromosome segregation protein; Provisional
403-671 4.61e-06

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 48.50  E-value: 4.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  403 QTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELE-----SFSATMEEVAASSNEVATAAESALDNAERGVDSGQDA 477
Cdd:PRK02224 160 QLGKLEEYRERASDARLGVERVLSDQRGSLDQLKAQIEekeekDLHERLNGLESELAELDEEIERYEEQREQARETRDEA 239
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  478 KAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTN-----ILALNANIEAARVDADGDGFGVVA-----DEV 547
Cdd:PRK02224 240 DEVLEEHEERREELETLEAEIEDLRETIAETEREREELAEEVRdlrerLEELEEERDDLLAEAGLDDADAEAvearrEEL 319
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  548 KSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAAT 627
Cdd:PRK02224 320 EDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRER 399
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 76802246  628 VEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVE 671
Cdd:PRK02224 400 FGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERVE 443
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
406-679 1.27e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 47.37  E-value: 1.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    406 ALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERgvdSGQDAKAVTDEVN 485
Cdd:TIGR02169  671 SEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEK---LKERLEELEEDLS 747
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    486 ELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNilALNANIEAARVDADGDGFGVVADEVKSL---ANETQQYTDEIR 562
Cdd:TIGR02169  748 SLEQEIENVKSELKELEARIEELEEDLHKLEEALN--DLEARLSHSRIPEIQAELSKLEEEVSRIearLREIEQKLNRLT 825
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    563 DRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEandeqaaTVEEVTATVDEVREQA 642
Cdd:TIGR02169  826 LEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLES-------RLGDLKKERDELEAQL 898
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 76802246    643 HEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATE 679
Cdd:TIGR02169  899 RELERKIEELEAQIEKKRKRLSELKAKLEALEEELSE 935
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
588-679 1.53e-05

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 45.74  E-value: 1.53e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    588 EVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLS 667
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90
                   ....*....|..
gi 76802246    668 ERVERLSTDATE 679
Cdd:smart00283  81 SAVEELEESSDE 92
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
401-673 1.57e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 46.99  E-value: 1.57e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    401 EDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESF-----------SATMEEVAASSNEVATAAESALDNAER 469
Cdd:TIGR02169  687 KRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLeqeeeklkerlEELEEDLSSLEQEIENVKSELKELEAR 766
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    470 GVDSGQDAKAVTDEVNELSEQLVDS-----VAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDadgdgfgvva 544
Cdd:TIGR02169  767 IEELEEDLHKLEEALNDLEARLSHSripeiQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQ---------- 836
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    545 dEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQ 624
Cdd:TIGR02169  837 -ELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKK 915
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*....
gi 76802246    625 AATVEEVTATVDEVREQAHEVKQETNDIVEEAEtQEAAVGTLSERVERL 673
Cdd:TIGR02169  916 RKRLSELKAKLEALEEELSEIEDPKGEDEEIPE-EELSLEDVQAELQRV 963
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
420-673 7.11e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 44.66  E-value: 7.11e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    420 SIDRQVEDQTESLEEVSNELESFSATMEEVAASsnevATAAESALDNAErgvdsgqdakavtDEVNELSEQLVDSVAELD 499
Cdd:TIGR02168  660 VITGGSAKTNSSILERRREIEELEEKIEELEEK----IAELEKALAELR-------------KELEELEEELEQLRKELE 722
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    500 EYMAEIGEV-VDIIADVADQTNILALNANIEAARVDADgdgfgVVADEVKSLANETQQYTDEIRDRIETVQgqtdttvEE 578
Cdd:TIGR02168  723 ELSRQISALrKDLARLEAEVEQLEERIAQLSKELTELE-----AEIEELEERLEEAEEELAEAEAEIEELE-------AQ 790
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    579 VERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAET 658
Cdd:TIGR02168  791 IEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEE 870
                          250
                   ....*....|....*
gi 76802246    659 QEAAVGTLSERVERL 673
Cdd:TIGR02168  871 LESELEALLNERASL 885
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
200-338 7.72e-05

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 41.63  E-value: 7.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   200 FESIPYGVFLIDDENTMLGYNTAINRLLGLDADhrEFLGRDCRETLAAatyTDNSRHHALADKVVDAPRNADEEwdverr 279
Cdd:pfam08448   1 LDSLPDALAVLDPDGRVRYANAAAAELFGLPPE--ELLGKTLAELLPP---EDAARLERALRRALEGEEPIDFL------ 69
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 76802246   280 edtfsfignddivygdtsVSVNTEGEETHIDFLAAPIFDDDGELRAVIELVEDRSEAVR 338
Cdd:pfam08448  70 ------------------EELLLNGEERHYELRLTPLRDPDGEVIGVLVISRDITERRR 110
Ttg2C COG1463
ABC-type transport system involved in resistance to organic solvents, periplasmic component ...
454-589 7.79e-05

ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism]


Pssm-ID: 224380 [Multi-domain]  Cd Length: 359  Bit Score: 43.99  E-value: 7.79e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 454 NEVATAAESALDnaergvDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARV 533
Cdd:COG1463 161 NAILNEAAAALA------GTGPQLNALLDNLAQFTDALNARDGDIGALIANLNQLLDSLAAASDQLDRLLDNLATLTAAL 234
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 76802246 534 DADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREV 589
Cdd:COG1463 235 AARRDALDDALAALSALAATVNDLLAENRPNLNQALANLRPLATLLVDYLPGLEQL 290
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
335-628 1.29e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 43.89  E-value: 1.29e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    335 EAVREQKELNGLVTEVTDTLDSIgTGELSSRadfDGDDELVEDELLDVVEAVNGMAENFEQLVIRVEDqteaLAESIARA 414
Cdd:TIGR02168  236 ELREELEELQEELKEAEEELEEL-TAELQEL---EEKLEELRLEVSELEEEIEELQKELYALANEISR----LEQQKQIL 307
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    415 TDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDS 494
Cdd:TIGR02168  308 RERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSK 387
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    495 VAELDEYMAEIGevvdiiadvADQTNILALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDT 574
Cdd:TIGR02168  388 VAQLELQIASLN---------NEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQAELEELEEELEELQEELER 458
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....
gi 76802246    575 TVEEVERTNDHIREVREEIDESLSALDELSESIeDAAEGIQEVAEANDEQAATV 628
Cdd:TIGR02168  459 LEEALEELREELEEAEQALDAAERELAQLQARL-DSLERLQENLEGFSEGVKAL 511
PRK01156 PRK01156
chromosome segregation protein; Provisional
489-674 1.41e-04

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 43.74  E-value: 1.41e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  489 EQLVDSVAEL----DEYMAEIGEVVDIIADVADQTNILALNANieAARVDADGDGFGVVADEVKSLANETQQYTDEIRDR 564
Cdd:PRK01156 532 EDIKIKINELkdkhDKYEEIKNRYKSLKLEDLDSKRTSWLNAL--AVISLIDIETNRSRSNEIKKQLNDLESRLQEIEIG 609
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  565 IETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAatveEVTATVDEVREQAHE 644
Cdd:PRK01156 610 FPDDKSYIDKSIREIENEANNLNNKYNEIQENKILIEKLRGKIDNYKKQIAEIDSIIPDLK----EITSRINDIEDNLKK 685
                        170       180       190
                 ....*....|....*....|....*....|
gi 76802246  645 VKQETNDIVEEAETQEAAVGTLSERVERLS 674
Cdd:PRK01156 686 SRKALDDAKANRARLESTIEILRTRINELS 715
DUF812 pfam05667
Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of ...
518-674 1.77e-04

Protein of unknown function (DUF812); This family consists of several eukaryotic proteins of unknown function.


Pssm-ID: 253309 [Multi-domain]  Cd Length: 536  Bit Score: 43.21  E-value: 1.77e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   518 QTNILALNANIEAARVDAD-GDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDES 596
Cdd:pfam05667 203 RQAAQAGTTGSSSADDLADlLSKFRLDSWDKGSRFTRTEKVEQAATAAAEVPPAEMDTEEDRTKEREAELEALQEQIDEL 282
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   597 LSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDevreqaheVKQETNDIVEEAETQ----EAAVGTLSERVER 672
Cdd:pfam05667 283 ESSIEEVLSEIKALASKIKQVNEELTTVRQENEELEEEYK--------IKKRTVELLPDAENNvaklQALVVASSERLLE 354

                  ..
gi 76802246   673 LS 674
Cdd:pfam05667 355 LA 356
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
422-676 1.86e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 43.52  E-value: 1.86e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    422 DRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESA---------LDNAERGVDSGQ------DAKAVTDEVNE 486
Cdd:TIGR02169  169 DRKKEKALEELEEVEENIERLDLIIDEKRQQLERLRREREKAeryqallkeKREYEGYELLKEkealerQKEAIERQLAS 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    487 LSEQLVDSVAELDEYMAEIGEVVDIIADVAD-------------QTNILALNANIEAARvdadgDGFGVVADEVKSLANE 553
Cdd:TIGR02169  249 LEEELEKLTEEISELEKRLEEIEQLLEELNKkikdlgeeeqlrvKEKIGELEAEIASLE-----RSIAEKERELEDAEER 323
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    554 TQQYTDEI----------RDRIETVQGQTDTTVEEVERTNDHIREVREEI-------DESLSALDELSESIEDAAEGIQE 616
Cdd:TIGR02169  324 LAKLEAEIdkllaeieelEREIEEERKRRDKLTEEYAELKEELEDLRAELeevdkefAETRDELKDYREKLEKLKREINE 403
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    617 VAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTD 676
Cdd:TIGR02169  404 LKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAAD 463
PRK02224 PRK02224
chromosome segregation protein; Provisional
564-679 1.99e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 43.49  E-value: 1.99e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  564 RIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAH 643
Cdd:PRK02224 210 GLESELAELDEEIERYEEQREQARETRDEADEVLEEHEERREELETLEAEIEDLRETIAETEREREELAEEVRDLRERLE 289
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 76802246  644 EVKQETNDIVEEAETQEAAVGTLSERVERLSTDATE 679
Cdd:PRK02224 290 ELEEERDDLLAEAGLDDADAEAVEARREELEDRDEE 325
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
390-500 2.19e-04

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 42.27  E-value: 2.19e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    390 AENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAER 469
Cdd:smart00283 146 AKEIESLIKEIQEETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDE 225
                           90       100       110
                   ....*....|....*....|....*....|.
gi 76802246    470 GVDSGQDAKAVTDEVNELSEQLVDSVAELDE 500
Cdd:smart00283 226 IAQVTQETAAMSEEISAAAEELSGLAEELDE 256
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
546-683 2.31e-04

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 43.16  E-value: 2.31e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  546 EVKSLANETQQYTDEIRD-RIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQ 624
Cdd:COG1196  207 RQAEKAERYQELKAELRElELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEEL 286
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 76802246  625 AATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATENDGD 683
Cdd:COG1196  287 QEELLELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETL 345
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
327-686 2.36e-04

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 43.12  E-value: 2.36e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    327 IELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVEDELLDV--VEavngMAENFEQLVIRVEDQT 404
Cdd:TIGR01612 1401 LEECKSKIESTLDDKDIDECIKKIKELKNHILSEESNIDTYFKNADENNENVLLLFknIE----MADNKSQHILKIKKDN 1476
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    405 ---------EALAESIARAT---DSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAaesaldnaergvd 472
Cdd:TIGR01612 1477 atndhdfniNELKEHIDKSKgckDEADKNAKAIEKNKELFEQYKKDVTELLNKYSALAIKNKFAKTK------------- 1543
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    473 sgQDAKAVTDEVNELSEQLVDSVAELDEYMAEI-GEVVDIIADVA--DQTNILALNANIEAARVDadgDGFGVVADeVKS 549
Cdd:TIGR01612 1544 --KDSEIIIKEIKDAHKKFILEAEKSEQKIKEIkKEKFRIEDDAAknDKSNKAAIDIQLSLENFE---NKFLKISD-IKK 1617
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    550 LANETQQYTDEIRDRIETVQGQTDTTveevertndhirEVREEIDeSLSALDELSESIEDAAEGIQEVAEANDEQAATVE 629
Cdd:TIGR01612 1618 KINDCLKETESIEKKISSFSIDSQDT------------ELKENGD-NLNSLQEFLESLKDQKKNIEDKKKELDELDSEIE 1684
                          330       340       350       360       370       380
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    630 EVTATVDEvREQAHEVK--QETNDIVEEAETQEAAVGTLSE-RVERLSTDATENDGDGFD 686
Cdd:TIGR01612 1685 KIEIDVDQ-HKKNYEIGiiEKIKEIAIANKEEIESIKELIEpTIENLISSFNTNDLEGID 1743
EzrA pfam06160
Septation ring formation regulator, EzrA; During the bacterial cell cycle, the tubulin-like ...
400-656 3.88e-04

Septation ring formation regulator, EzrA; During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation.


Pssm-ID: 253592 [Multi-domain]  Cd Length: 560  Bit Score: 42.17  E-value: 3.88e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   400 VEDQTEALAESIARATDSAHSIDrqVEDQTESLEEVSNELESFSATME-EVAASsNEVATAAESALDNAERGVDSGQDAK 478
Cdd:pfam06160 250 IEKELQDLKEQIDQNLALLEELD--LDEAEEENEEIEERIDALYDILEkEVKAK-KFVEKNIDKLTEFLEHAKEQNKQLL 326
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   479 AVTDEVNE---LSEQLVDSVAELDEYMAEIGEVVDIIadvadqtnilalnanieaarvdadgdgfgvvadeVKSLANETQ 555
Cdd:pfam06160 327 LELDRLQQsytLNHDELETVRELEKQLEELEKQYEQL----------------------------------VERIAEKKV 372
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   556 QYTdEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIED-----------------------AAE 612
Cdd:pfam06160 373 AYS-ELQEELEAILKQLEEIEKEQEELSESLQGLRKDELEAREKLQEYRQKLHEikryleksnlpglpedyleyffvVSD 451
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....
gi 76802246   613 GIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDIVEEA 656
Cdd:pfam06160 452 EIEALADELNEVPINMDAVNRQLEEATDDVETLKEKTEELVDNA 495
EzrA COG4477
Negative regulator of septation ring formation [Cell division and chromosome partitioning]
430-656 5.10e-04

Negative regulator of septation ring formation [Cell division and chromosome partitioning]


Pssm-ID: 226883 [Multi-domain]  Cd Length: 570  Bit Score: 41.98  E-value: 5.10e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 430 ESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNE---LSEQLVDSVAELDEYMAEIG 506
Cdd:COG4477 281 EELGLIQEKIESLYDLLEREVEAKNVVEENLPILPDYLEKAKENNEHLKEEIERVKEsyrLAETELGSVRKFEKELKELE 360
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 507 EVVDIIADVADQTNILALNANIEAARVDadgDGFGVVADEVKSLANETQQYTD---EIRDRIETVQGQTDTTVEEVERTN 583
Cdd:COG4477 361 SVLDEILENIEAQEVAYSELQDNLEEIE---KALTDIEDEQEKVQEHLTSLRKdelEARENLERLKSKLHEIKRYMEKSN 437
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 76802246 584 dhIREVREEIdesLSALDELSESIEDAAEGIQEVAeandeqaATVEEVTATVDEVREQAHEVKQETNDIVEEA 656
Cdd:COG4477 438 --LPGLPETF---LSLFFTAGHEIQDLMKELSEVP-------INMEAVSALVDIATEDMNTLEDETEEVVENA 498
NtpI COG1269
Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion]
419-678 5.37e-04

Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion]


Pssm-ID: 224188 [Multi-domain]  Cd Length: 660  Bit Score: 41.96  E-value: 5.37e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 419 HSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAErgvdSGQDAKAVTDEVNELSEQLVDSVAEL 498
Cdd:COG1269  50 KVAEVAQISLSSLLSEVLDYLRSVKGLEGRLFILPEEVEKLEAELKSLEE----VIKPAEKFSSEVEELTRKLEERLSEL 125
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 499 DEYMAEIG---EVVDIIADVADQTNILALN--ANIEAARVDADGDG--FGVVADEVKSLANETQQ-------YTDEIRDR 564
Cdd:COG1269 126 DEELEDLEdllEELEPLAYLDFDLSLLRGLkfLLVRLGLVRREKLEalVGVIEDEVALYGENVEAsvvivvaHGAEDLDK 205
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 565 IETVQGQTDTTVEEV--ERTNDH--IREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVRE 640
Cdd:COG1269 206 VSKILNELGFELYEVpeFDGGPSelISELEEVIAEIQDELESLRSELEALAEKIAEELLAVREILEIEKALGDVLSKLAR 285
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 76802246 641 QAHevkqetnDIVEEAETQEAAVGTLSERVERLSTDAT 678
Cdd:COG1269 286 TEY-------TLAIEGWVPADEVEKLKKIINRATGGAA 316
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
376-638 7.13e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 41.59  E-value: 7.13e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    376 EDELLDVVEAVNGMAENfEQLviRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNE 455
Cdd:TIGR02169  271 EQLLEELNKKIKDLGEE-EQL--RVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEE 347
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    456 VA---TAAESALDNA-ERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEV---VDIIADVADQTNILALNANI 528
Cdd:TIGR02169  348 ERkrrDKLTEEYAELkEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELkreLDRLQEELQRLSEELADLNA 427
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    529 EAARVDADgdgfgvvadevkslANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIE 608
Cdd:TIGR02169  428 AIAGIEAK--------------INELEEEKEDKALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDRVEKELSKLQRELA 493
                          250       260       270
                   ....*....|....*....|....*....|
gi 76802246    609 DAAEGIQEVAEANDEQAATVEEVTATVDEV 638
Cdd:TIGR02169  494 EAEAQARASEERVRGGRAVEEVLKASIQGV 523
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
400-670 7.30e-04

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 41.36  E-value: 7.30e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  400 VEDQTEALAESIARATDSAHSIDrqVEDQTESLEEVSNELESFSATME-EVAASsNEVATAAESALDNAERGVDSGQDAK 478
Cdd:PRK04778 254 IEKEIQDLKEQIDENLALLEELD--LDEAEEKNEEIQERIDQLYDILErEVKAR-KYVEKNSDTLPDFLEHAKEQNKELK 330
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  479 AVTDEVNE---LSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNIL--ALNANIEAARvdadgDGFGVVADEVKSLANE 553
Cdd:PRK04778 331 EEIDRVKQsytLNESELESVRQLEKQLESLEKQYDEITERIAEQEIAysELQEELEEIL-----KQLEEIEKEQEKLSEM 405
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  554 TQQ-YTDEI--RDRIETVQGQTDTTVEEVERTNdhIREVREEIdesLSALDELSESIEdaaegiqEVAEANDEQAATVEE 630
Cdd:PRK04778 406 LQGlRKDELeaREKLERYRNKLHEIKRYLEKSN--LPGLPEDY---LEMFFEVSDEIE-------ALAEELEEKPINMEA 473
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 76802246  631 VTATVDEVREQAHEVKQETNDIVEEAetqeaavgTLSERV 670
Cdd:PRK04778 474 VNRLLEEATEDVETLEEETEELVENA--------TLTEQL 505
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
433-655 7.95e-04

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 41.31  E-value: 7.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   433 EEVSNELESFSATMEEvAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDII 512
Cdd:PTZ00341  926 KELKNQNENVPEHLKE-HAEANIEEDAEENVEEDAEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENIE 1004
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   513 ADVADQtnilaLNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDriETVQGQTDTTVEEVERTNdhIREVREE 592
Cdd:PTZ00341 1005 ENVEEN-----VEENIEENVEEYDEENVEEVEENVEEYDEENVEEIEENAE--ENVEENIEENIEEYDEEN--VEEIEEN 1075
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 76802246   593 IDESLSalDELSESIEDAAEGIQEVAEANDEQAATvEEVTATVDE-VREQAHEVKQETNDIVEE 655
Cdd:PTZ00341 1076 IEENIE--ENVEENVEENVEEIEENVEENVEENAE-ENAEENAEEnAEEYDDENPEEHNEEYDE 1136
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
346-688 1.04e-03

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 256862 [Multi-domain]  Cd Length: 1198  Bit Score: 41.21  E-value: 1.04e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    346 LVTEVTDTLDSIG---TGELSSRADFDgdDELVEDEL----------LDVVEaVNGMAENFEQLVIRVEDQTEALA---E 409
Cdd:pfam12128  545 LRNEAPGWEESIGkviSPELLERTDLD--PQLVEGSDsdtlygvsldLQRLD-VPDYAANETELRERLQQAEEALQsavA 621
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    410 SIARATDSAHSIDRQVEDQTESLEEVSNELESFSATME----EVAASSNEVATAAESALDNAERGVDS-GQDAKAVTDEV 484
Cdd:pfam12128  622 KQKQAEEQLVQANAELEEQKRAEAEARTALKQARLDLQrlqnEQQSLKDKLELAIAERKQQAETQLRQlDAQLKQLLEQQ 701
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    485 NELSEQLVDSVAELDEYMAEIGEVVdiIADVADQtnILALNANIEAARVDADG-------------DGFGVVADEVKSLA 551
Cdd:pfam12128  702 QAFLEALKDDFRELRTERLAKWQVV--EGELDNQ--LAQLSAAIEAARTQAKArlkelkkqydrelASLDVDPNTVKELK 777
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    552 NETQQYTDEI----RDRIETVQ---------GQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIE-DAAEGIQEV 617
Cdd:pfam12128  778 RQIEELETTIeriaVRRPEVREyrafmqetwLHRDSLREERPNLAIQLRELESSAEELQQELTRLIKDTKlRRKKLEQER 857
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    618 AEANDEQAATVEEVTATVDEVR-----------EQAHEVKQETNDIVEEA-ETQEAAVGTLSERVERLSTDATENDGDGF 685
Cdd:pfam12128  858 KALEKQLDQLDELLRGLRDEMRqlaelkepanaNQAEGSISERLDQLEEFkRKRKRLSGDLKKFLERFDGVIKDHSGSGL 937

                   ...
gi 76802246    686 DET 688
Cdd:pfam12128  938 YET 940
MukB COG3096
Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome ...
328-681 1.15e-03

Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 41.03  E-value: 1.15e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  328 ELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDgDDELVEDELLDVvEAVNGMAENFEQLVIRVEDQTEAL 407
Cdd:COG3096  294 ELYTSRQQLAAEQYRHVDMSRELAELNGAEGDLEADYQAASD-HLNLVQTALRQQ-EKIERYQADLEELTIRLEEQNEVV 371
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  408 AESIARATDSahsidrqvEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVTDEVNEL 487
Cdd:COG3096  372 EEANERQEEN--------EARAEAAELEVDELKSQLADYQQALDVQQTRAIQYQQAIAALERAKELCHLPDLTADSAEEW 443
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  488 SEQLVDSVAELDEYMAEIGEVVDIiADVA----DQTNILALNANIEAARVDADGDGFGVVAD--EVKSLANETQQYTDEI 561
Cdd:COG3096  444 LETFQAKEEEATEKLLSLEQKMSM-AQAAhsqfEQAYQLVVAIAGELARSEAWDVARELLREgpDQRHLAEQVQPLRMRL 522
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  562 RDRIETVQGQTD-----TTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVT---- 632
Cdd:COG3096  523 SELEQRLRQQQSaerllADFCKRQGKNLDAEELEALHQELEALIESLSDSVSNAREQRMALRQEQEQLQSRIQSLMqrap 602
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 76802246  633 ------ATVDEVREQAHEVKQETNDIVEEAETQ--------------EAAVGTLSERVERLSTDATEND 681
Cdd:COG3096  603 vwlaaqNALEQLSEQSGEEFTDSQDVTEYMQQLlerereatverdelGARKNALDEEIERLSQPGGSED 671
PRK02224 PRK02224
chromosome segregation protein; Provisional
552-679 1.20e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 40.79  E-value: 1.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  552 NETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEV 631
Cdd:PRK02224 226 EEQREQARETRDEADEVLEEHEERREELETLEAEIEDLRETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLD 305
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 76802246  632 TATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATE 679
Cdd:PRK02224 306 DADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADD 353
V_ATPase_I pfam01496
V-type ATPase 116kDa subunit family; This family consists of the 116kDa V-type ATPase ...
391-658 1.30e-03

V-type ATPase 116kDa subunit family; This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.


Pssm-ID: 250661 [Multi-domain]  Cd Length: 694  Bit Score: 40.44  E-value: 1.30e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   391 ENFEQLVIRVEDqteaLAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAaSSNEVATAAESALDNAE-- 468
Cdd:pfam01496  67 KEFLDLKEEILD----LEAEIREVEENLESLEKEINELEEWLNVLDEEKSFLDENKLEEL-SELSNLDIDFKYLRGAEgl 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   469 RGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQtnilalnaniEAARVDADGDGFGVVADEVK 548
Cdd:pfam01496 142 KLFVAGVVNREKAEALERELWRVLRGQAEIEEPLEDPKKTVFIVFFVGKE----------ILDKVKKILESFGFELYDVP 211
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   549 SLANETQQYTDEIRDRIETVQgqtdttvEEVERTNDHIREVREEIDESLSALDELSESI--------------------- 607
Cdd:pfam01496 212 EVEGEPSELISKVNKRIEELK-------RVLETTESELEKVLVKIADELLAWDEQVSKEkakyetlnlfnydtkcliaeg 284
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 76802246   608 ---EDAAEGIQEVAEANDEQAATVEEVTATVDEvrEQAHEVKQETNDIVEEAET 658
Cdd:pfam01496 285 wvpAEDLEELKAALRNATEGSGSVPSIENDIET--NEEPPTYLKNNKFTAPFQM 336
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
320-503 1.35e-03

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 39.35  E-value: 1.35e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   320 DGELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIG--TGELS-------SRADFDGDD-ELVEDELLDVVEAVNGM 389
Cdd:pfam00015  15 LDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAfqTNLLAlnaaieaARAGEQGRGfAVVADEVRKLAERSAQA 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   390 AENFEQLVIRVEDQTEALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAER 469
Cdd:pfam00015  95 AKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSAGIDQVNQAVAR 174
                         170       180       190
                  ....*....|....*....|....*....|....
gi 76802246   470 GVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMA 503
Cdd:pfam00015 175 IDQVTQQNAALVEESAAAAETLEEQAEELTASVA 208
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
466-681 1.45e-03

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 40.47  E-value: 1.45e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  466 NAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNAnieaarvdadgdgfgvvaD 545
Cdd:COG1196  658 NKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQL------------------E 719
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  546 EVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQA 625
Cdd:COG1196  720 ELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELE 799
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 76802246  626 ATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATEND 681
Cdd:COG1196  800 EELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELE 855
PRK05771 PRK05771
V-type ATP synthase subunit I; Validated
378-612 1.60e-03

V-type ATP synthase subunit I; Validated


Pssm-ID: 235600 [Multi-domain]  Cd Length: 646  Bit Score: 40.30  E-value: 1.60e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  378 ELLDVVEAVNGMAENFEQLVIRVEDQTeaLAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVaassnEVA 457
Cdd:PRK05771  57 EALDKLRSYLPKLNPLREEKKKVSVKS--LEELIKDVEEELEKIEKEIKELEEEISELENEIKELEQEIERL-----EPW 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  458 TAAESALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADG 537
Cdd:PRK05771 130 GNFDLDLSLLLGFKYVSVFVGTVPEDKLEELKLESDVENVEYISTDKGYVYVVVVVLKELSDEVEEELKKLGFERLELEE 209
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 76802246  538 DGfgvVADEVKSlanetqqytdEIRDRIETVQgqtdttvEEVERTNDHIREVREEIDESLSALDELSESIEDAAE 612
Cdd:PRK05771 210 EG---TPSELIR----------EIKEELEEIE-------KERESLLEELKELAKKYLEELLALYEYLEIELERAE 264
AAA_13 pfam13166
AAA domain; This family of domains contain a P-loop motif that is characteristic of the AAA ...
404-593 2.09e-03

AAA domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. This family includes the PrrC protein that is thought to be the active component of the anticodon nuclease.


Pssm-ID: 257537 [Multi-domain]  Cd Length: 713  Bit Score: 39.99  E-value: 2.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   404 TEALAESIARAtdsahsIDRQVEDQTESLEEVSNELES-FSATMEEVAASSNEVATAAESALDNAErgvdSGQDAKAVTD 482
Cdd:pfam13166 265 TEERKAELEAH------FDEEYQELIEQLEELIDKYEShIEKALEELESILDTEKENSEFKLDVEE----LKALLEALEE 334
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   483 EVNELSEQLVD------SVAELDEYMAEIGEVVDIIADVADQTN-----ILALNANIEAARVDadgdgfgVVADEVKSLA 551
Cdd:pfam13166 335 ILEKNLQKLEEklkdpsTSIELESITDLIESINDIIDAINELIRehnekIDNLKKEKNKAKKK-------LWLHLVAELK 407
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 76802246   552 NETQQYTDEIRDR---IETVQGQTDTTVEEVERTNDHIREVREEI 593
Cdd:pfam13166 408 EDIDAYQKEKKGLekaINSLEKEIKQLEAEIKALEKEIKELEKQL 452
SbcC COG0419
ATPase involved in DNA repair [DNA replication, recombination, and repair]
322-673 2.33e-03

ATPase involved in DNA repair [DNA replication, recombination, and repair]


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 39.74  E-value: 2.33e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 322 ELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGTGELSSRADFDGDDELVEDELLDVVEAVNGMAENFEQLVIRVE 401
Cdd:COG0419 229 ELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELEREIEELEEELE 308
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 402 DQTeALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERGVDSGQDAKAVT 481
Cdd:COG0419 309 GLR-ALLEELEELLEKLKSLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEKALERLKQL 387
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 482 DEVN-ELSEQLVDSVAELDEYMAEIGEVVDIIADVADQ-----TNILALNANIEAARVDADGDGFGVVADEVKSLANE-- 553
Cdd:COG0419 388 EEAIqELKEELAELSAALEEIQEELEELEKELEELEREleeleEEIKKLEEQINQLESKELMIAELAGAGEKCPVCGQel 467
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 554 TQQYTDEIRDRIETVQGQTDTTVEEVERTNDhIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTA 633
Cdd:COG0419 468 PEEHEKELLELYELELEELEEELSREKEEAE-LREEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELE 546
                       330       340       350       360
                ....*....|....*....|....*....|....*....|..
gi 76802246 634 TVDE--VREQAHEVKQETNDIVEEAETQEAAVGTLSERVERL 673
Cdd:COG0419 547 ELKEklQLQQLKEELRQLEDRLQELKELLEELRLLRTRKEEL 588
COG1511 COG1511
Predicted membrane protein [Function unknown]
400-679 2.35e-03

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 39.80  E-value: 2.35e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 400 VEDQTEAL------AESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAEsaldnaergvDS 473
Cdd:COG1511 173 IYDLGGGVkgaadgAEKLKDGTDEASNGNKKLSDLLNTLNNSSATFSDGLNALTSGLTTLTDGLNQLD----------SG 242
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 474 GQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTN--ILALNANIEAArvdadgdgfGVVADEVKSLA 551
Cdd:COG1511 243 LGTLAAGIGELKQGAEQLNEGIGEFSSGLSELNSGVQDLAAGVPQLNqgISALAAGLSLP---------DSLGDQFSSLQ 313
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 552 NETQQYTDEIRDRIETVQGQTDTTVEEVertndhirevrEEIDESLSALDELSE----SIEDAAEGIQEVAEANDEQAAT 627
Cdd:COG1511 314 EALTQIAQGLKQKTSSSLEAAQGSLSSL-----------QSMLALSKSLDLTAEgatvDALGAPDGVQWLDESQKTLATL 382
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 76802246 628 VEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATE 679
Cdd:COG1511 383 SELLSTGIDGVSEGLDALEQASAQLAKSLAKLKTAVAQIAASIAQLLPGASE 434
PRK01156 PRK01156
chromosome segregation protein; Provisional
374-676 3.06e-03

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 39.50  E-value: 3.06e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  374 LVEDELLDVVEAVNGMAENFEQLVIRVEDQTEALAESIaraTDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASS 453
Cdd:PRK01156 462 LGEEKSNHIINHYNEKKSRLEEKIREIEIEVKDIDEKI---VDLKKRKEYLESEEINKSINEYNKIESARADLEDIKIKI 538
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  454 NEVATAAE--SALDNAERGVDSGQDAKAVTDEVNELSeqlVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAA 531
Cdd:PRK01156 539 NELKDKHDkyEEIKNRYKSLKLEDLDSKRTSWLNALA---VISLIDIETNRSRSNEIKKQLNDLESRLQEIEIGFPDDKS 615
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  532 RVDadgDGFGVVADEVKSLANETQQYTDEIRDRietvqgqtdttvEEVERTNDHIREVREEIDESLSALDELSESIEDAA 611
Cdd:PRK01156 616 YID---KSIREIENEANNLNNKYNEIQENKILI------------EKLRGKIDNYKKQIAEIDSIIPDLKEITSRINDIE 680
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802246  612 EGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQETNDI---VEEAETQEAAVGTLSERVERLSTD 676
Cdd:PRK01156 681 DNLKKSRKALDDAKANRARLESTIEILRTRINELSDRINDInetLESMKKIKKAIGDLKRLREAFDKS 748
AAA_27 pfam13514
AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain ...
405-676 3.73e-03

AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain contains a P-loop motif.


Pssm-ID: 257834 [Multi-domain]  Cd Length: 1112  Bit Score: 39.40  E-value: 3.73e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    405 EALAESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVA---ASSNEVATAAESALDNAERGVDSGQDAkaVT 481
Cdd:pfam13514  628 DELLDRRARLRAALRAALAAVADLGEELEELLTLARQLLEEAEKQSarrASLDERLSQAEHALETAEERHDEAQSA--LE 705
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    482 DEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQ-TNILALNANIEAARVDADGdgfgvVADEVKSLANETQQYTDE 560
Cdd:pfam13514  706 EWQEQWYDLLLEAGLGGRASPVGALDALELLQNIKEKlQAADDLRQRIAQMERDLAR-----FAEEVEALAKALAPEMLA 780
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    561 IRD-----RIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIED----AAEGIQEVAEANDEQAATVEEV 631
Cdd:pfam13514  781 TPAdelarALKARLKRARDTAAEADRLAEEIEEAEKQVSTAAAALDELEARLTAllraARVTTIEELLAAVERSDTYREL 860
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 76802246    632 TATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTD 676
Cdd:pfam13514  861 RRRLAALERTLERICGGLSLEALAAEKAALDPAELPARLELLARD 905
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
566-687 4.04e-03

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 39.00  E-value: 4.04e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   566 ETVQGQTDTTVEE--VERTNDHIREVREEIDESLSALDE--LSESIEDAAEGIQEVAEANDEQ--AATVEEVTATVDE-- 637
Cdd:PTZ00341 1001 ENIEENVEENVEEniEENVEEYDEENVEEVEENVEEYDEenVEEIEENAEENVEENIEENIEEydEENVEEIEENIEEni 1080
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 76802246   638 -------VREQAHEVKQETNDIVEEaETQEAAVGTLSERVERLSTDATENDGDGFDE 687
Cdd:PTZ00341 1081 eenveenVEENVEEIEENVEENVEE-NAEENAEENAEENAEEYDDENPEEHNEEYDE 1136
mukB PRK04863
cell division protein MukB; Provisional
320-648 4.28e-03

cell division protein MukB; Provisional


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 39.17  E-value: 4.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   320 DGELRAVIELVEDRSEAVREQKELNGLVTEVTDTLDSIGtgelSSRADFDGDDELVEDELLDVVEA-------------V 386
Cdd:PRK04863  282 RVHLEEALELRRELYTSRRQLAAEQYRLVEMARELAELN----EAESDLEQDYQAASDHLNLVQTAlrqqekieryqadL 357
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   387 NGMAENFEQLVIRVEDQTEALAESIARATDSAHSIDR---QVED--------QT---------ESLEEV-------SNEL 439
Cdd:PRK04863  358 EELEERLEEQNEVVEEADEQQEENEARAEAAEEEVDElksQLADyqqaldvqQTraiqyqqavQALERAkqlcglpDLTA 437
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   440 ESFSATMEEVAASSNEVAtaaeSALDNAERGVDSGQDAKAVTDEVNELSEQLVDSVA-------------ELDEYMAEIG 506
Cdd:PRK04863  438 DNAEDWLEEFQAKEQEAT----EELLSLEQKLSVAQAAHSQFEQAYQLVRKIAGEVSrseawdvarellrRLREQRHLAE 513
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   507 EVVDIIADVADQTNILALNANIEAARVDadgdgFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHI 586
Cdd:PRK04863  514 QLQQLRMRLSELEQRLRQQQRAERLLAE-----FCKRLGKNLDDEDELEQLQEELEARLESLSESVSEARERRMALRQQL 588
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 76802246   587 REVREEIDE----------SLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQE 648
Cdd:PRK04863  589 EQLQARIQRlaarapawlaAQDALARLREQSGEEFEDSQDVTEYMQQLLERERELTVERDELAARKQALDEE 660
PTZ00341 PTZ00341
Ring-infected erythrocyte surface antigen; Provisional
566-695 4.95e-03

Ring-infected erythrocyte surface antigen; Provisional


Pssm-ID: 173534 [Multi-domain]  Cd Length: 1136  Bit Score: 39.00  E-value: 4.95e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   566 ETVQGQTDTTVEE--VERTNDHIREVREEIDESLSALDE--LSESIEDAAEGIQEVAEANDEQaaTVEEVTATVDEvrEQ 641
Cdd:PTZ00341  993 ENVEENVEENIEEnvEENVEENIEENVEEYDEENVEEVEenVEEYDEENVEEIEENAEENVEE--NIEENIEEYDE--EN 1068
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 76802246   642 AHEVKQETNDIVEE--AETQEAAVGTLSERVERLSTDATENDGDGFDETTAEDSDD 695
Cdd:PTZ00341 1069 VEEIEENIEENIEEnvEENVEENVEEIEENVEENVEENAEENAEENAEENAEEYDD 1124
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
399-695 5.98e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 38.64  E-value: 5.98e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    399 RVEDQTEALAESIARATDSAHSI--DRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAERgvDSGQD 476
Cdd:TIGR02680  760 ELARELRALGARQRALADELAGApsDRSLRAAHRRAAEAERQAESAERELARAARKAAAAAAAWKQARRELER--DAADL 837
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    477 AKAVT----DEVNELSEQLVDSVAELDEYMAEIGEVVDIIADV---ADQTNILALNANIEAARVDADGDGFGVvadEVKS 549
Cdd:TIGR02680  838 DLPTDpdalEAVGLALKRFGDHLHTLEVAVRELRHAATRAAEQrarAARAESDAREAAEDAAEARAEAEEASL---RLRT 914
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    550 LANETQQYTDEIRDRIETVQgqtdttvEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVE 629
Cdd:TIGR02680  915 LEESVGAMVDEIRARLAETR-------AALASGGRELPRLAEALATAEEARGRAEEKRAEADATLDERAEARDHAIGQLR 987
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    630 EVTAT-VDEVR-----EQAHEVKQETNDIVEEAETQEAAVG-------TLSERVERLSTDATEND---GDGFDETTAEDS 693
Cdd:TIGR02680  988 EFALTgLLEDAlpdteVPELDAKWTIEAALKVARRTEAALLqvadddeALDRAANRISEEYLELRrtlAALGDDAQMEPA 1067

                   ..
gi 76802246    694 DD 695
Cdd:TIGR02680 1068 DD 1069
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
430-679 6.24e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length [Hypothetical proteins, Conserved].


Pssm-ID: 233973 [Multi-domain]  Cd Length: 1353  Bit Score: 38.64  E-value: 6.24e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    430 ESLEEVSNELESFSATMEEVAASSNEVATAAESALDnaERGVDsgqDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVV 509
Cdd:TIGR02680  749 ARLAAVDDELAELARELRALGARQRALADELAGAPS--DRSLR---AAHRRAAEAERQAESAERELARAARKAAAAAAAW 823
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    510 DIIADvadqtnilALNANIEAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVqgqtdttvEEVERTNDHIREV 589
Cdd:TIGR02680  824 KQARR--------ELERDAADLDLPTDPDALEAVGLALKRFGDHLHTLEVAVRELRHAA--------TRAAEQRARAARA 887
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    590 REEIDESLSALDElsesIEDAAEGIQEVAEANDEQ-AATVEEVTATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSE 668
Cdd:TIGR02680  888 ESDAREAAEDAAE----ARAEAEEASLRLRTLEESvGAMVDEIRARLAETRAALASGGRELPRLAEALATAEEARGRAEE 963
                          250
                   ....*....|.
gi 76802246    669 RVERLSTDATE 679
Cdd:TIGR02680  964 KRAEADATLDE 974
MDN1 COG5271
AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction ...
369-695 6.43e-03

AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 38.44  E-value: 6.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  369 DGDDELVEDE--LLDVV----EAVNGMAENFEQLVIRVED----QTEALAESIARATDSAHSIDRQVEDQTESLEEVSNE 438
Cdd:COG5271 3947 DKDRQEKEDEeeMSDDVgiddEIQPDIQENNSQPPPENEDldlpEDLKLDEKEGDVSKDSDLEDMDMEAADENKEEADAE 4026
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  439 LESfsATMEEVAASSNEVATAAESALDNAERGVDSGQ-DAKAVTDEVNELSEQLVDSVAeLDEYMAEIGEVVDIIADVAD 517
Cdd:COG5271 4027 KDE--PMQDEDPLEENNTLDEDIQQDDFSDLAEDDEKmNEDGFEENVQENEESTEDGVK-SDEELEQGEVPEDQAIDNHP 4103
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  518 QTNILALNAnieAARVDADGDGFGVVADevkslaNETQQYTDEIRDrietvQGQTDTTVEEVERTNDHIREVREEIDESL 597
Cdd:COG5271 4104 KMDAKSTFA---SAEADEENTDKGIVGE------NEELGEEDGVRG-----NGTADGEFEQVQEDTSTPKEAMSEADRQY 4169
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  598 SAL-DELSESiedaaegiqevaeandEQAATVEEvTATVDEVREQAhEVKQETNDIVEEAETQEAAVGTLS-ERVERLST 675
Cdd:COG5271 4170 QSLgDHLREW----------------QQANRIHE-WEDLTESQSQA-FDDSEFMHVKEDEEEDLQALGNAEkDQIKSIDR 4231
                        330       340
                 ....*....|....*....|..
gi 76802246  676 D-ATENDGDGFDETT-AEDSDD 695
Cdd:COG5271 4232 DeSANQNPDSMNSTNiAEDEAD 4253
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
488-679 6.46e-03

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 38.05  E-value: 6.46e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 488 SEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANIEAARVDADGD--GFGVVADEVKSLANETQQYTDEIRDRI 565
Cdd:COG0840  16 AGEADAGLLKLKKLIDELGKLLLSLNLILDDAASAEAAALKAVLKFLLISLlvAIIVVLVLAILLLRAILEPISDLLEVV 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246 566 ETVqGQTDTTVEEVERTNDHIREVREEIDESLSAL-----------DELSESIEDAAEGIQEVAEANDEQAATVEEVTAT 634
Cdd:COG0840  96 ERI-AAGDLTKRIDESSNDEFGQLAKSFNEMILNLrqiidavqdnaEALSGASEEIAASATELSARADQQAESLEEVASA 174
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*
gi 76802246 635 VDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLSTDATE 679
Cdd:COG0840 175 IEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQE 219
TPR_MLP1_2 pfam07926
TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of ...
589-661 6.87e-03

TPR/MLP1/MLP2-like protein; The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.


Pssm-ID: 254520 [Multi-domain]  Cd Length: 132  Bit Score: 36.12  E-value: 6.87e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   589 VREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVE--------------EVTATVDEVREQAHEVKQETNDIVE 654
Cdd:pfam07926   1 LKEEKSSLQAELKRLLEKKEDAEAKIQKLQEDLEEQAEIANeaqqkyerelvkhaEDIEELQALREQLNELKKEIAQLKA 80

                  ....*..
gi 76802246   655 EAETQEA 661
Cdd:pfam07926  81 EAESAQA 87
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
349-691 7.71e-03

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 38.03  E-value: 7.71e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    349 EVTDTLDSIGTGELSSRADFDGDDELVEDELLDVVEAVNGM---AENFEQLVIRVEDQTEALAESIARATDSAHSIDRQV 425
Cdd:TIGR00618  542 TSEEDVYHQLTSERKQRASLKEQMQEIQQSFSILTQCDNRSkedIPNLQNITVRLQDLTEKLSEAEDMLACEQHALLRKL 621
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    426 EDQTESL----------EEVSNELESFSATMEEVAASSNEVATAA------------ESALDNAERGVDSGQDAKAVTDE 483
Cdd:TIGR00618  622 QPEQDLQdvrlhlqqcsQELALKLTALHALQLTLTQERVREHALSirvlpkellasrQLALQKMQSEKEQLTYWKEMLAQ 701
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    484 VNELSEQLVDSVAELDEYMAEIGEVVD-IIADVadQTNILALNANIEAARVDADgdgfgvvaDEVKSLANETQQYTDEir 562
Cdd:TIGR00618  702 CQTLLRELETHIEEYDREFNEIENASSsLGSDL--AAREDALNQSLKELMHQAR--------TVLKARTEAHFNNNEE-- 769
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246    563 driETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQEVAE---ANDEQA--ATVEEVTATVDE 637
Cdd:TIGR00618  770 ---VTAALQTGAELSHLAAEIQFFNRLREEDTHLLKTLEAEIGQEIPSDEDILNLQCetlVQEEEQflSRLEEKSATLGE 846
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....
gi 76802246    638 VREQAHEVkQETNDIVEEAETQEAAVGTLSERVERLSTDATENDGDGFDETTAE 691
Cdd:TIGR00618  847 ITHQLLKY-EECSKQLAQLTQEQAKIIQLSDKLNGINQIKIQFDGDALIKFLHE 899
Spc7 pfam08317
Spc7 kinetochore protein; This domain is found in cell division proteins which are required ...
482-616 8.12e-03

Spc7 kinetochore protein; This domain is found in cell division proteins which are required for kinetochore-spindle association.


Pssm-ID: 254725 [Multi-domain]  Cd Length: 324  Bit Score: 37.71  E-value: 8.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246   482 DEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADqtnilALNANIEaarvdadgdgfgvvadEVKSLANETQQYTdei 561
Cdd:pfam08317 152 DGLEENLEGLKRDDELLNKDLNLINSIKPKLRKKLQ-----ALKEEIA----------------SLRQLADEPNLCD--- 207
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 76802246   562 RDRIETVQGQTDTTVEEVERTNDHIREVREEIDESLSALDELSESIEDAAEGIQE 616
Cdd:pfam08317 208 PLELEKARQELRSLSVKISEKRKKLEELQQELQELTIKIEAGTNQKSELLEEIAE 262
MDN1 COG5271
AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction ...
545-694 8.29e-03

AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 38.06  E-value: 8.29e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  545 DEVKSLANE--TQQYTDEIRDRIETVQGQT-----DTTVEEVErtNDHIREVREEIDESLSALDE-LSESIED------A 610
Cdd:COG5271 3835 DDLEELANEedTANQSDLDESEARELESDMngvtkDSVVSENE--NSDSEEENQDLDEEVNDIPEdLSNSLNEklwdepN 3912
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802246  611 AEGIQEVAEANDEQAATVEEV---------TATVDEVREQAHEVKQETNDIVEEAETQEAAVGTLSERVERLST-DATEN 680
Cdd:COG5271 3913 EEDLLETEQKSNEQSAANNESdlvskeddnKALEDKDRQEKEDEEEMSDDVGIDDEIQPDIQENNSQPPPENEDlDLPED 3992
                        170
                 ....*....|....*
gi 76802246  681 -DGDGFDETTAEDSD 694
Cdd:COG5271 3993 lKLDEKEGDVSKDSD 4007
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH