NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|76802201|ref|YP_327209|]
View 

transducer protein htr23 [Natronomonas pharaonis DSM 2160]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
76-119 7.96e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


:

Pssm-ID: 100122  Cd Length: 48  Bit Score: 40.70  E-value: 7.96e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....
gi 76802201  76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKT 119
Cdd:cd06225   5 LRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLRE 48
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
252-458 1.51e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 132.36  E-value: 1.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 252 NDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQT 331
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 332 NILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVET 411
Cdd:cd11386  81 NLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 76802201 412 VTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVR 458
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
230-492 1.63e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.68  E-value: 1.63e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    230 IRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQ 309
Cdd:smart00283   6 VEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEE 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    310 LEQQMDDVSETTELIDDIAEQTNILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHA 389
Cdd:smart00283  86 LEESSDEIGEIVSVIDDIADQTNLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQE 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    390 DVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRSR 469
Cdd:smart00283 159 ETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSE 238
                          250       260
                   ....*....|....*....|...
gi 76802201    470 DLAEAADETAASMGDVQSATAGL 492
Cdd:smart00283 239 EISAAAEELSGLAEELDELVERF 261
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
76-119 7.96e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 40.70  E-value: 7.96e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....
gi 76802201  76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKT 119
Cdd:cd06225   5 LRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLRE 48
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
252-458 1.51e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 132.36  E-value: 1.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 252 NDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQT 331
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 332 NILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVET 411
Cdd:cd11386  81 NLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 76802201 412 VTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVR 458
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
76-119 4.56e-05

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 41.83  E-value: 4.56e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 76802201    76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKT 119
Cdd:pfam00672  27 LRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRLRE 70
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
76-122 5.49e-05

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 41.46  E-value: 5.49e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 76802201     76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKTALE 122
Cdd:smart00304   7 LRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
230-492 1.63e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.68  E-value: 1.63e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    230 IRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQ 309
Cdd:smart00283   6 VEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEE 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    310 LEQQMDDVSETTELIDDIAEQTNILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHA 389
Cdd:smart00283  86 LEESSDEIGEIVSVIDDIADQTNLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQE 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    390 DVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRSR 469
Cdd:smart00283 159 ETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSE 238
                          250       260
                   ....*....|....*....|...
gi 76802201    470 DLAEAADETAASMGDVQSATAGL 492
Cdd:smart00283 239 EISAAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
79-477 6.71e-38

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 143.98  E-value: 6.71e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  79 LTDTAAAIEQGELDESVDS--RRNDEIGSLFSAFDDMRLSLKTALEESEAAKQD---------AQAARQEAEQLNEALLE 147
Cdd:COG0840   7 LNLELIELAAGEADAGLLKlkKLIDELGKLLLSLNLILDDAASAEAAALKAVLKfllisllvaIIVVLVLAILLLRAILE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 148 HADEIGTAMEDAAAGDFTTELDSDTDiDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEaadiaemnreva 227
Cdd:COG0840  87 PISDLLEVVERIAAGDLTKRIDESSN-DEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAAS------------ 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 228 gdIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELgslI 307
Cdd:COG0840 154 --ATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEV---V 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 308 EQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGgadvgegFAVVADEVKSLAEETQSAVGEIDGIVETA 387
Cdd:COG0840 229 KKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRG-------FAVVADEVRKLAERSADSAKEIGLLIEEI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 388 HADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADR 467
Cdd:COG0840 302 QNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAA 381
                       410
                ....*....|
gi 76802201 468 SRDLAEAADE 477
Cdd:COG0840 382 VEELAAASEE 391
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
282-506 3.71e-24

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 100.60  E-value: 3.71e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   282 GEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGgadvgegFAV 361
Cdd:pfam00015   7 AQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRG-------FAV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   362 VADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATD 441
Cdd:pfam00015  80 VADEVRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASD 159
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 76802201   442 EGASGTEEVAATIDsvretadavadrsrDLAEAADETAASMGDVQSATAGLADRTGDLRARLDTF 506
Cdd:pfam00015 160 EQSAGIDQVNQAVA--------------RIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
204-482 1.25e-16

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 81.92  E-value: 1.25e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  204 DVEETSEdVAAEAADIAEMNREV---AGDIRELADEIADQSEQLHAAvaeTNDLSAAIEEVASTTDEVAtqaADAAEVGA 280
Cdd:PRK15041 242 EVDGSNE-MGQLAESLRHMQGELmrtVGDVRNGANAIYSGASEIATG---NNDLSSRTEQQAASLEETA---ASMEQLTA 314
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  281 EGEQRAEDAIEAIE---NVGESVAELGSLIEQLEQQMDDVSETTE-------LIDDIAEQTNILALNANIEAARAGGSGG 350
Cdd:PRK15041 315 TVKQNAENARQASHlalSASETAQRGGKVVDNVVQTMRDISTSSQkiadiisVIDGIAFQTNILALNAAVEAARAGEQGR 394
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  351 GgadvgegFAVVADEVKSLAEETQSAVGEIDGIVETahadvrdvtaemeaTTEEVDQSVETVTEAGETFQSLTGTVEDID 430
Cdd:PRK15041 395 G-------FAVVAGEVRNLAQRSAQAAREIKSLIED--------------SVGKVDVGSTLVESAGETMAEIVSAVTRVT 453
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 76802201  431 TAMQDIAKATDEGASGTEEVA---ATIDSVRETADAVADRSRDLAEAADETAASM 482
Cdd:PRK15041 454 DIMGEIASASDEQSRGIDQVGlavAEMDRVTQQNAALVEESAAAAAALEEQASRL 508
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
195-504 4.81e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 58.14  E-value: 4.81e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    195 LDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAetnDLSAAIEEVASTTDEVATQAAD 274
Cdd:TIGR02168  679 IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRK---DLARLEAEVEQLEERIAQLSKE 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    275 AAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGGAD 354
Cdd:TIGR02168  756 LTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAA 835
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    355 VGEGFAVVADEVKSLAEETQSAVGEIdgivETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQ 434
Cdd:TIGR02168  836 TERRLEDLEEQIEELSEDIESLAAEI----EELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRS 911
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 76802201    435 DIAKATDEGASGTEEVAATIDSVRETADAVADRSRDLAE-AADETAASMGDVQSATAGLADRTGDLRARLD 504
Cdd:TIGR02168  912 ELRRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYSlTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
114-319 3.89e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 55.06  E-value: 3.89e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    114 RLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAAGDFTTELDS---DTDIDAIDRIAAAYDRMAAD 190
Cdd:TIGR02168  672 ILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQIsalRKDLARLEAEVEQLEERIAQ 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    191 LSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVAT 270
Cdd:TIGR02168  752 LSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLER 831
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*....
gi 76802201    271 QAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSE 319
Cdd:TIGR02168  832 RIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLN 880
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
75-332 5.12e-08

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 54.72  E-value: 5.12e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   75 ELQRLTDTAAAIEQ--GELDESVDSRrNDEIGSLFSAFDDMRlslkTALEESEAAKQDAQAARQEAEQLNEALLEHADEI 152
Cdd:COG1196  240 ELEELEEELSRLEEelEELQEELEEA-EKEIEELKSELEELR----EELEELQEELLELKEEIEELEGEISLLRERLEEL 314
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  153 GTAMEDAAAGDFTTE---LDSDTDIDAIDRIAAAYDRMAADLSVTLDE----LRAFAADVEETSEDVAAEAADIAEMNRE 225
Cdd:COG1196  315 ENELEELEERLEELKekiEALKEELEERETLLEELEQLLAELEEAKEEleekLSALLEELEELFEALREELAELEAELAE 394
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  226 VAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGS 305
Cdd:COG1196  395 IRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQE 474
                        250       260
                 ....*....|....*....|....*..
gi 76802201  306 LIEQLEQQMDDVSETTELIDDIAEQTN 332
Cdd:COG1196  475 ELQRLEKELSSLEARLDRLEAEQRASQ 501
PTZ00121 PTZ00121
MAEBL; Provisional
121-494 9.90e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 9.90e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   121 LEESEAAKQDAQAARQ-----EAEQLNEAL-LEHADEIGTAMEDAAAGDF--TTELDSDTDIDAIDRIAAAYDR--MA-- 188
Cdd:PTZ00121 1502 AKKAAEAKKKADEAKKaeeakKADEAKKAEeAKKADEAKKAEEKKKADELkkAEELKKAEEKKKAEEAKKAEEDknMAlr 1581
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   189 -ADLSVTLDELR-AFAADVEETSEDVAAEAADIAEMNREVAGDIRElADEIADQSEQLHAAVAETNDLSaaiEEVASTTD 266
Cdd:PTZ00121 1582 kAEEAKKAEEARiEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKK-AEEEKKKVEQLKKKEAEEKKKA---EELKKAEE 1657
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   267 EVATQAADAAEVGAEGEQRAEDAIEAIENvgESVAElgsliEQLEQQMDDVSETTELIDDIAEQTNilalnanieaarag 346
Cdd:PTZ00121 1658 ENKIKAAEEAKKAEEDKKKAEEAKKAEED--EKKAA-----EALKKEAEEAKKAEELKKKEAEEKK-------------- 1716
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   347 gSGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDgIVETAHADVRDVTAEMEATTEEVDQSVETVTEAG------ETFQ 420
Cdd:PTZ00121 1717 -KAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAK-KDEEEKKKIAHLKKEEEKKAEEIRKEKEAVIEEEldeedeKRRM 1794
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   421 SLTGTVEDIDTAMQDIAKATDEGA-----------SGTEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSAT 489
Cdd:PTZ00121 1795 EVDKKIKDIFDNFANIIEGGKEGNlvindskemedSAIKEVADSKNMQLEEADAFEKHKFNKNNENGEDGNKEADFNKEK 1874

                  ....*
gi 76802201   490 AGLAD 494
Cdd:PTZ00121 1875 DLKED 1879
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
117-329 2.58e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 256862 [Multi-domain]  Cd Length: 1198  Bit Score: 42.75  E-value: 2.58e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    117 LKTALEESEAAKQDA-QAARQEAEQLNEALLEHADEIGTAMEDAAAgdftteldSDTDIDAIDRIAAAY-DRMAADLSVT 194
Cdd:pfam12128  279 LAEEQEERQEAKNRLrQQLRTLEDQLKEARDELNQELSAANAKLAA--------DRSELELLEDQKGAFeDADIEQLQAD 350
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    195 LDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHaavaetndlsaaiEEVASTTDEVATQAAD 274
Cdd:pfam12128  351 LDQLPSIRSELEEVEARLDALTGKHQDVQRKYERLKQKIKEQLERDLEKNN-------------ERLAAIREEKDRQKAA 417
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 76802201    275 AAEV--GAEGEQRAEDAiEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAE 329
Cdd:pfam12128  418 IEEDlqALESQLRQQLE-AGKLEFNEEEYELELRLGRLKQRLDSATATPEELEQLEI 473
 
Name Accession Description Interval E-value
HAMP cd06225
Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. ...
76-119 7.96e-05

Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices connected by an extended linker. The structure of the HAMP dimer from Archaeoglobus fulgidus has been solved using nuclear magnetic resonance, revealing a parallel four-helix bundle; this structure has been confirmed by cross-linking analysis of HAMP domains from the Escherichia coli aerotaxis receptor Aer. It has been suggested that the four-helix arrangement can rotate between the unusually packed conformation observed in the NMR structure and a canonical coiled-coil arrangement. Such rotation may coincide with signal transduction, but a common mechanism by which HAMP domains relay a variety of input signals has yet to be established.


Pssm-ID: 100122  Cd Length: 48  Bit Score: 40.70  E-value: 7.96e-05
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....
gi 76802201  76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKT 119
Cdd:cd06225   5 LRRLAEAAQRIAAGDLDVRLPVTGRDEIGELARAFNQMAERLRE 48
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
252-458 1.51e-35

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 132.36  E-value: 1.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 252 NDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQT 331
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 332 NILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVET 411
Cdd:cd11386  81 NLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 76802201 412 VTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVR 458
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
HAMP pfam00672
HAMP domain;
76-119 4.56e-05

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 41.83  E-value: 4.56e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 76802201    76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKT 119
Cdd:pfam00672  27 LRRLAEAARRIASGDLDDRVPVSGPDEIGELARAFNQMADRLRE 70
HAMP smart00304
HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;
76-122 5.49e-05

HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain;


Pssm-ID: 197640  Cd Length: 53  Bit Score: 41.46  E-value: 5.49e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 76802201     76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKTALE 122
Cdd:smart00304   7 LRRLAEAAQRIADGDLTVRLPVDGRDEIGELARAFNEMADRLEETIA 53
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
230-492 1.63e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 156.68  E-value: 1.63e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    230 IRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQ 309
Cdd:smart00283   6 VEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVSAVEE 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    310 LEQQMDDVSETTELIDDIAEQTNILALNANIEaaraggsGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHA 389
Cdd:smart00283  86 LEESSDEIGEIVSVIDDIADQTNLLALNAAIE-------AARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQE 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    390 DVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRSR 469
Cdd:smart00283 159 ETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSE 238
                          250       260
                   ....*....|....*....|...
gi 76802201    470 DLAEAADETAASMGDVQSATAGL 492
Cdd:smart00283 239 EISAAAEELSGLAEELDELVERF 261
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
79-477 6.71e-38

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 143.98  E-value: 6.71e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  79 LTDTAAAIEQGELDESVDS--RRNDEIGSLFSAFDDMRLSLKTALEESEAAKQD---------AQAARQEAEQLNEALLE 147
Cdd:COG0840   7 LNLELIELAAGEADAGLLKlkKLIDELGKLLLSLNLILDDAASAEAAALKAVLKfllisllvaIIVVLVLAILLLRAILE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 148 HADEIGTAMEDAAAGDFTTELDSDTDiDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEaadiaemnreva 227
Cdd:COG0840  87 PISDLLEVVERIAAGDLTKRIDESSN-DEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAAS------------ 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 228 gdIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELgslI 307
Cdd:COG0840 154 --ATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEV---V 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 308 EQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGgadvgegFAVVADEVKSLAEETQSAVGEIDGIVETA 387
Cdd:COG0840 229 KKLSESSQEIEEITSVINSIAEQTNLLALNAAIEAARAGEAGRG-------FAVVADEVRKLAERSADSAKEIGLLIEEI 301
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 388 HADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADR 467
Cdd:COG0840 302 QNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINASIEELDDVTQENAAA 381
                       410
                ....*....|
gi 76802201 468 SRDLAEAADE 477
Cdd:COG0840 382 VEELAAASEE 391
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
282-506 3.71e-24

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 100.60  E-value: 3.71e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   282 GEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGgadvgegFAV 361
Cdd:pfam00015   7 AQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRG-------FAV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   362 VADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATD 441
Cdd:pfam00015  80 VADEVRKLAERSAQAAKEIEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASD 159
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 76802201   442 EGASGTEEVAATIDsvretadavadrsrDLAEAADETAASMGDVQSATAGLADRTGDLRARLDTF 506
Cdd:pfam00015 160 EQSAGIDQVNQAVA--------------RIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 210
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
204-482 1.25e-16

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 81.92  E-value: 1.25e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  204 DVEETSEdVAAEAADIAEMNREV---AGDIRELADEIADQSEQLHAAvaeTNDLSAAIEEVASTTDEVAtqaADAAEVGA 280
Cdd:PRK15041 242 EVDGSNE-MGQLAESLRHMQGELmrtVGDVRNGANAIYSGASEIATG---NNDLSSRTEQQAASLEETA---ASMEQLTA 314
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  281 EGEQRAEDAIEAIE---NVGESVAELGSLIEQLEQQMDDVSETTE-------LIDDIAEQTNILALNANIEAARAGGSGG 350
Cdd:PRK15041 315 TVKQNAENARQASHlalSASETAQRGGKVVDNVVQTMRDISTSSQkiadiisVIDGIAFQTNILALNAAVEAARAGEQGR 394
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  351 GgadvgegFAVVADEVKSLAEETQSAVGEIDGIVETahadvrdvtaemeaTTEEVDQSVETVTEAGETFQSLTGTVEDID 430
Cdd:PRK15041 395 G-------FAVVAGEVRNLAQRSAQAAREIKSLIED--------------SVGKVDVGSTLVESAGETMAEIVSAVTRVT 453
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 76802201  431 TAMQDIAKATDEGASGTEEVA---ATIDSVRETADAVADRSRDLAEAADETAASM 482
Cdd:PRK15041 454 DIMGEIASASDEQSRGIDQVGlavAEMDRVTQQNAALVEESAAAAAALEEQASRL 508
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
196-490 1.45e-15

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 78.19  E-value: 1.45e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  196 DELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELA---DEIADQSEQLHAAVAETndlSAAIEEVASTTDEVATQA 272
Cdd:PRK09793 243 NEITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVagnNDLSSRTEQQAASLAQT---AASMEQLTATVGQNADNA 319
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  273 ADAAEVgaegeqrAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEaaraggsGGGG 352
Cdd:PRK09793 320 RQASEL-------AKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVE-------AARA 385
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  353 ADVGEGFAVVADEVKSLAEETQSAVGEIDGIVetahadvrdvtaemEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTA 432
Cdd:PRK09793 386 GEQGRGFAVVAGEVRNLASRSAQAAKEIKGLI--------------EESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDI 451
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 76802201  433 MQDIAKATDEGASGTEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSATA 490
Cdd:PRK09793 452 MGEIASASEEQRRGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVA 509
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
141-488 3.40e-14

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 73.89  E-value: 3.40e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  141 LNEALLEHADEIGTAMEDAAAGDFTTELDSDTDiDAIDRIAAAYDRMAADLSVTLdelrafaADVEETSEDVAAEAADIA 220
Cdd:PRK15048 212 IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGR-SEMGDLAQSVSHMQRSLTDTV-------THVREGSDAIYAGTREIA 283
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  221 EMNrevagdirelaDEIADQSEQLHAAVAETndlSAAIEEVASTTDEVATQAADAAevgaegeQRAEDAIEAIENVGESV 300
Cdd:PRK15048 284 AGN-----------TDLSSRTEQQASALEET---AASMEQLTATVKQNADNARQAS-------QLAQSASDTAQHGGKVV 342
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  301 AELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGgadvgegFAVVADEVKSLAEETQSAVGEI 380
Cdd:PRK15048 343 DGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRG-------FAVVAGEVRNLASRSAQAAKEI 415
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  381 DGIVETahadvrdvtaemeaTTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVA---ATIDSV 457
Cdd:PRK15048 416 KALIED--------------SVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVAlavSEMDRV 481
                        330       340       350
                 ....*....|....*....|....*....|.
gi 76802201  458 RETADAVADRSRDLAEAADETAASMGDVQSA 488
Cdd:PRK15048 482 TQQNASLVQESAAAAAALEEQASRLTQAVSA 512
PRK02224 PRK02224
chromosome segregation protein; Provisional
116-504 3.46e-09

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 58.51  E-value: 3.46e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  116 SLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAagdfttelDSDTDIDAIDRIAAAYDRMAADLSVTL 195
Cdd:PRK02224 217 ELDEEIERYEEQREQARETRDEADEVLEEHEERREELETLEAEIE--------DLRETIAETEREREELAEEVRDLRERL 288
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  196 DELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAEtndlsaaIEEVASTTDEVATQAADA 275
Cdd:PRK02224 289 EELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEE-------AESLREDADDLEERAEEL 361
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  276 AEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSET----TELIDDIAEQTNIL-----ALNANIEAARAG 346
Cdd:PRK02224 362 REEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDlgnaEDFLEELREERDELrereaELEATLRTARER 441
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  347 GSGGGGADVGEGFAVVADEVKSlaEETQSAVGEIDGIVETAHADVrdvtAEMEATTEEVDQSVETVTEAGETfqslTGTV 426
Cdd:PRK02224 442 VEEAEALLEAGKCPECGQPVEG--SPHVETIEEDRERVEELEAEL----EDLEEEVEEVEERLERAEDLVEA----EDRI 511
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802201  427 EDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSATAGLADRTGDLRARLD 504
Cdd:PRK02224 512 ERLEERREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIE 589
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
195-504 4.81e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 58.14  E-value: 4.81e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    195 LDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAetnDLSAAIEEVASTTDEVATQAAD 274
Cdd:TIGR02168  679 IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRK---DLARLEAEVEQLEERIAQLSKE 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    275 AAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGGAD 354
Cdd:TIGR02168  756 LTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAA 835
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    355 VGEGFAVVADEVKSLAEETQSAVGEIdgivETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQ 434
Cdd:TIGR02168  836 TERRLEDLEEQIEELSEDIESLAAEI----EELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRS 911
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 76802201    435 DIAKATDEGASGTEEVAATIDSVRETADAVADRSRDLAE-AADETAASMGDVQSATAGLADRTGDLRARLD 504
Cdd:TIGR02168  912 ELRRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYSlTLEEAEALENKIEDDEEEARRRLKRLENKIK 982
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
82-415 8.92e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 57.37  E-value: 8.92e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201     82 TAAAIEQGELDESVDSRRNDEIgSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAA 161
Cdd:TIGR02168  701 AELRKELEELEEELEQLRKELE-ELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAE 779
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    162 GDFTTElDSDTDIDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMnrevagdIRELADEIADQS 241
Cdd:TIGR02168  780 AEAEIE-ELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERR-------LEDLEEQIEELS 851
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    242 EQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETT 321
Cdd:TIGR02168  852 EDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRL 931
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    322 ELID-DIAEQTNILALNANIEaarAGGSGGGGADVGEGFAVVADEVKSLAEETQsAVGEIDGIVETAHADVRDVTAEMEA 400
Cdd:TIGR02168  932 EGLEvRIDNLQERLSEEYSLT---LEEAEALENKIEDDEEEARRRLKRLENKIK-ELGPVNLAAIEEYEELKERYDFLTA 1007
                          330
                   ....*....|....*
gi 76802201    401 TTEEVDQSVETVTEA 415
Cdd:TIGR02168 1008 QKEDLTEAKETLEEA 1022
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
89-442 1.57e-08

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 56.26  E-value: 1.57e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   89 GELDESVDSRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAAgdfttel 168
Cdd:COG1196  655 GSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAA------- 727
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  169 dSDTDIDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAV 248
Cdd:COG1196  728 -LEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAE 806
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  249 AETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIA 328
Cdd:COG1196  807 RRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEK 886
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  329 EQtnilaLNANIEAARAGGSGGGGADVGEGFAVVADEVKSLAEETQSAVGEI---DGIVETAHADVRDVTAEMEATTEEV 405
Cdd:COG1196  887 EE-----LEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEeleEEYEDTLETELEREIERLEEEIEAL 961
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|.
gi 76802201  406 DQ----SVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDE 442
Cdd:COG1196  962 GPvnlrAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEE 1002
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
114-319 3.89e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 55.06  E-value: 3.89e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    114 RLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAAGDFTTELDS---DTDIDAIDRIAAAYDRMAAD 190
Cdd:TIGR02168  672 ILERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQIsalRKDLARLEAEVEQLEERIAQ 751
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    191 LSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVAT 270
Cdd:TIGR02168  752 LSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLER 831
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*....
gi 76802201    271 QAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSE 319
Cdd:TIGR02168  832 RIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLN 880
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
75-332 5.12e-08

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 54.72  E-value: 5.12e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   75 ELQRLTDTAAAIEQ--GELDESVDSRrNDEIGSLFSAFDDMRlslkTALEESEAAKQDAQAARQEAEQLNEALLEHADEI 152
Cdd:COG1196  240 ELEELEEELSRLEEelEELQEELEEA-EKEIEELKSELEELR----EELEELQEELLELKEEIEELEGEISLLRERLEEL 314
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  153 GTAMEDAAAGDFTTE---LDSDTDIDAIDRIAAAYDRMAADLSVTLDE----LRAFAADVEETSEDVAAEAADIAEMNRE 225
Cdd:COG1196  315 ENELEELEERLEELKekiEALKEELEERETLLEELEQLLAELEEAKEEleekLSALLEELEELFEALREELAELEAELAE 394
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  226 VAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGS 305
Cdd:COG1196  395 IRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQE 474
                        250       260
                 ....*....|....*....|....*..
gi 76802201  306 LIEQLEQQMDDVSETTELIDDIAEQTN 332
Cdd:COG1196  475 ELQRLEKELSSLEARLDRLEAEQRASQ 501
PRK02224 PRK02224
chromosome segregation protein; Provisional
77-512 2.95e-07

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 52.35  E-value: 2.95e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   77 QRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAM 156
Cdd:PRK02224 213 SELAELDEEIERYEEQREQARETRDEADEVLEEHEERREELETLEAEIEDLRETIAETEREREELAEEVRDLRERLEELE 292
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  157 EDAAAGDFTTELDsDTDIDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADE 236
Cdd:PRK02224 293 EERDDLLAEAGLD-DADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESE 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  237 IADQSEQLhaavaetNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEqqmDD 316
Cdd:PRK02224 372 LEEAREAV-------EDRREEIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTAR---ER 441
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  317 VSETTELIddiaEQTNILALNANIEAARAGGSGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAhADVRDVTA 396
Cdd:PRK02224 442 VEEAEALL----EAGKCPECGQPVEGSPHVETIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEAE-DRIERLEE 516
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  397 EMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRS------RD 470
Cdd:PRK02224 517 RREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIesleriRT 596
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|..
gi 76802201  471 LAEAADETAASMGDVQSATAGLADRTGDLRARLDTFSTRDSD 512
Cdd:PRK02224 597 LLAAIADAEDEIERLREKREALAELNDERRERLAEKRERKRE 638
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
185-493 1.51e-06

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 50.10  E-value: 1.51e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  185 DRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREV---AGDIRELADEIADQSEQLHAAVAETNDLSAAIEEV 261
Cdd:COG1196  221 ELRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELeeaEKEIEELKSELEELREELEELQEELLELKEEIEEL 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  262 ASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEqtnilalnanie 341
Cdd:COG1196  301 EGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLS------------ 368
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  342 aaraggsggggadvgegfaVVADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQS 421
Cdd:COG1196  369 -------------------ALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKE 429
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 76802201  422 LTGTVEDIDTAMQDIAkatdegasgtEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSATAGLA 493
Cdd:COG1196  430 LEAELEELQTELEELN----------EELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLD 491
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
97-400 1.78e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 46.60  E-value: 1.78e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201     97 SRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEallehadeigtamedaaagdftteldsdtDIDA 176
Cdd:TIGR02169  698 RRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEE-----------------------------DLSS 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    177 IDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADiaEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSA 256
Cdd:TIGR02169  749 LEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEARLSH--SRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTL 826
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    257 AIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDV-SETTELIDDIAE-QTNIL 334
Cdd:TIGR02169  827 EKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLkKERDELEAQLRElERKIE 906
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 76802201    335 ALNANIEAARAGGSGGGGADvgegfAVVADEVKSLAEETQSAV--GEIDGIVETAHADVRDVTAEMEA 400
Cdd:TIGR02169  907 ELEAQIEKKRKRLSELKAKL-----EALEEELSEIEDPKGEDEeiPEEELSLEDVQAELQRVEEEIRA 969
PRK02224 PRK02224
chromosome segregation protein; Provisional
224-508 3.58e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 45.42  E-value: 3.58e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  224 REVAGDIRELADEIADQSEQ-LHAAVaetNDLSAAIEEVASTTDEVATQAADAAEvgaegeqRAEDAIEAIENVGESVAE 302
Cdd:PRK02224 183 SDQRGSLDQLKAQIEEKEEKdLHERL---NGLESELAELDEEIERYEEQREQARE-------TRDEADEVLEEHEERREE 252
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  303 LGSLIEQLEQQMDDVSETTELIDDIAEQTNILAlnanieaaraggsggggadvgegfavvaDEVKSLAEETQSAVGEI-- 380
Cdd:PRK02224 253 LETLEAEIEDLRETIAETEREREELAEEVRDLR----------------------------ERLEELEEERDDLLAEAgl 304
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  381 -DGIVETAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRE 459
Cdd:PRK02224 305 dDADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRRE 384
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 76802201  460 TADAVADRSRDLAEAADETAASMGDVQSATAGLADRTGDLRARLDTFST 508
Cdd:PRK02224 385 EIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEA 433
Smc COG1196
Chromosome segregation ATPases [Cell division and chromosome partitioning]
76-331 4.65e-05

Chromosome segregation ATPases [Cell division and chromosome partitioning]


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 45.09  E-value: 4.65e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTA 155
Cdd:COG1196  736 QSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERE 815
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  156 MED--AAAGDFTTELDSDTD--IDAIDRIAAAYDRMA------ADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNRE 225
Cdd:COG1196  816 LESleQRRERLEQEIEELEEeiEELEEKLDELEEELEelekelEELKEELEELEAEKEELEDELKELEEEKEELEEELRE 895
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  226 VAGDIRELADEIADQSEQLHAAVAE---TNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAE------DAIEAIENV 296
Cdd:COG1196  896 LESELAELKEEIEKLRERLEELEAKlerLEVELPELEEELEEEYEDTLETELEREIERLEEEIEAlgpvnlRAIEEYEEV 975
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 76802201  297 GESVAELGSLIEQLEQQMDDVSETTELIDDIAEQT 331
Cdd:COG1196  976 EERYEELKSQREDLEEAKEKLLEVIEELDKEKRER 1010
NtrY COG5000
Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation ...
76-145 8.37e-05

Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms]


Pssm-ID: 227333 [Multi-domain]  Cd Length: 712  Bit Score: 43.99  E-value: 8.37e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 76802201  76 LQRLTDTAAAIEQGELDESVDSRRNDE-IGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEAL 145
Cdd:COG5000 309 IRKLIEAADEVADGDLDVQVPVRRVDEdVGRLSKAFNKMTEQLSSQQEALERAKDALEQRRRFLEAVLSGL 379
PTZ00121 PTZ00121
MAEBL; Provisional
121-494 9.90e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 44.36  E-value: 9.90e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   121 LEESEAAKQDAQAARQ-----EAEQLNEAL-LEHADEIGTAMEDAAAGDF--TTELDSDTDIDAIDRIAAAYDR--MA-- 188
Cdd:PTZ00121 1502 AKKAAEAKKKADEAKKaeeakKADEAKKAEeAKKADEAKKAEEKKKADELkkAEELKKAEEKKKAEEAKKAEEDknMAlr 1581
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   189 -ADLSVTLDELR-AFAADVEETSEDVAAEAADIAEMNREVAGDIRElADEIADQSEQLHAAVAETNDLSaaiEEVASTTD 266
Cdd:PTZ00121 1582 kAEEAKKAEEARiEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKK-AEEEKKKVEQLKKKEAEEKKKA---EELKKAEE 1657
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   267 EVATQAADAAEVGAEGEQRAEDAIEAIENvgESVAElgsliEQLEQQMDDVSETTELIDDIAEQTNilalnanieaarag 346
Cdd:PTZ00121 1658 ENKIKAAEEAKKAEEDKKKAEEAKKAEED--EKKAA-----EALKKEAEEAKKAEELKKKEAEEKK-------------- 1716
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   347 gSGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDgIVETAHADVRDVTAEMEATTEEVDQSVETVTEAG------ETFQ 420
Cdd:PTZ00121 1717 -KAEELKKAEEENKIKAEEAKKEAEEDKKKAEEAK-KDEEEKKKIAHLKKEEEKKAEEIRKEKEAVIEEEldeedeKRRM 1794
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   421 SLTGTVEDIDTAMQDIAKATDEGA-----------SGTEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSAT 489
Cdd:PTZ00121 1795 EVDKKIKDIFDNFANIIEGGKEGNlvindskemedSAIKEVADSKNMQLEEADAFEKHKFNKNNENGEDGNKEADFNKEK 1874

                  ....*
gi 76802201   490 AGLAD 494
Cdd:PTZ00121 1875 DLKED 1879
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
188-444 2.31e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 42.74  E-value: 2.31e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    188 AADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAG----------DIRELADEIADQSEQLHAAVAETNDLSAA 257
Cdd:TIGR02168  224 ELELALLVLRLEELREELEELQEELKEAEEELEELTAELQEleekleelrlEVSELEEEIEELQKELYALANEISRLEQQ 303
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    258 IEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEA--------------IENVGESVAELGSLIEQLEQQMDDVSET-TE 322
Cdd:TIGR02168  304 KQILRERLANLERQLEELEAQLEELESKLDELAEElaeleekleelkeeLESLEAELEELEAELEELESRLEELEEQlET 383
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    323 LIDDIAEQTNILALNAN----IEAARAGGSGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAHADVRDVTAEM 398
Cdd:TIGR02168  384 LRSKVAQLELQIASLNNeierLEARLERLEDRRERLQQEIEELLKKLEEAELKELQAELEELEEELEELQEELERLEEAL 463
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 76802201    399 EATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGA 444
Cdd:TIGR02168  464 EELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVK 509
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
117-329 2.58e-04

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 256862 [Multi-domain]  Cd Length: 1198  Bit Score: 42.75  E-value: 2.58e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    117 LKTALEESEAAKQDA-QAARQEAEQLNEALLEHADEIGTAMEDAAAgdftteldSDTDIDAIDRIAAAY-DRMAADLSVT 194
Cdd:pfam12128  279 LAEEQEERQEAKNRLrQQLRTLEDQLKEARDELNQELSAANAKLAA--------DRSELELLEDQKGAFeDADIEQLQAD 350
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    195 LDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHaavaetndlsaaiEEVASTTDEVATQAAD 274
Cdd:pfam12128  351 LDQLPSIRSELEEVEARLDALTGKHQDVQRKYERLKQKIKEQLERDLEKNN-------------ERLAAIREEKDRQKAA 417
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 76802201    275 AAEV--GAEGEQRAEDAiEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAE 329
Cdd:pfam12128  418 IEEDlqALESQLRQQLE-AGKLEFNEEEYELELRLGRLKQRLDSATATPEELEQLEI 473
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
171-407 4.05e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 41.98  E-value: 4.05e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    171 DTDIDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAA--------EAADIAEMNREVAGDIRELADEIADQSE 242
Cdd:TIGR02169  236 ERQKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKkikdlgeeEQLRVKEKIGELEAEIASLERSIAEKER 315
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    243 QLHAAVAETNDLSAAIEEVASTTDEVATQaadAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTE 322
Cdd:TIGR02169  316 ELEDAEERLAKLEAEIDKLLAEIEELERE---IEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYRE 392
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    323 LIDDIAEQTNILALNANIEAARAGGSGGGGADVGEGFAVVADEVKSLAEETQSAVGEI---DGIVETAHADVRDVTAEME 399
Cdd:TIGR02169  393 KLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIkkqEWKLEQLAADLSKYEQELY 472

                   ....*...
gi 76802201    400 ATTEEVDQ 407
Cdd:TIGR02169  473 DLKEEYDR 480
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
36-333 4.35e-04

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 41.51  E-value: 4.35e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  36 HAAAGDTAELAIPALTGTAFVFTLNLGLLGLVLAGNVTVELQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRL 115
Cdd:COG0840  48 ASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDEFGQLAKSFNEMIL 127
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 116 SLKTALEE--------SEAAKQDAQAARQEAEQLN-------------EALLEHADEIGTAMEDAAAGDFTTELDSDTDI 174
Cdd:COG0840 128 NLRQIIDAvqdnaealSGASEEIAASATELSARADqqaesleevasaiEELSETVKEVAFNAKEAAALASEASQVAEEGG 207
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 175 DAIDRIAAAYDRMAADLSVTLDELRAFAADVEETS------------------------------------------EDV 212
Cdd:COG0840 208 EEVRQAVEQMQEIAEELAEVVKKLSESSQEIEEITsvinsiaeqtnllalnaaieaarageagrgfavvadevrklaERS 287
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 213 AAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEGEQRAEDAIEA 292
Cdd:COG0840 288 ADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAATEEQTAVLEEINAS 367
                       330       340       350       360
                ....*....|....*....|....*....|....*....|.
gi 76802201 293 IENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQTNI 333
Cdd:COG0840 368 IEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
AAA_27 pfam13514
AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain ...
116-506 6.18e-04

AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain contains a P-loop motif.


Pssm-ID: 257834 [Multi-domain]  Cd Length: 1112  Bit Score: 41.33  E-value: 6.18e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    116 SLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMED----AAAGDFTTELDSDTDIDAIDRIAAAYDRMAADL 191
Cdd:pfam13514  350 ELETRKEALDQALKVARDALEERERELKQVRAQLAAVPTVTVPeplrAALSDALRLGDIDAALAAEEQEVAVAKRELAQA 429
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    192 SVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQ 271
Cdd:pfam13514  430 LSRLGLWRTDLAALGALALPSAEQVQAFLKEYEEIMQAKRQKRDRLLEVTEDLETLRLQLKLLRAAGAVVTSAEVAVARV 509
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    272 AADA-----------AEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQtnILALNANI 340
Cdd:pfam13514  510 RRDQlwsdaallsatASAYEEAVESADQLADRLLREAQLAAELQSLRQQEEAASRRLAQLEKELEVLKLE--LAALDEAW 587
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    341 EAARAGGSGGGGADVGEGFAVVADEVKSLAEETQSAVGEIDGIVETAH----------ADVRDVTAEMEATTEEVDQSVE 410
Cdd:pfam13514  588 RAQAAAAGTPTSPAAMEDWLAERDTAREQVRDAFKARAELDELLDRRArlraalraalAAVADLGEELEELLTLARQLLE 667
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    411 TVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATIDSVRETADAVADRSRDLAEAADETAASMGDVQSATA 490
Cdd:pfam13514  668 EAEKQSARRASLDERLSQAEHALETAEERHDEAQSALEEWQEQWYDLLLEAGLGGRASPVGALDALELLQNIKEKLQAAD 747
                          410
                   ....*....|....*.
gi 76802201    491 GLADRTGDLRARLDTF 506
Cdd:pfam13514  748 DLRQRIAQMERDLARF 763
COG4372 COG4372
Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]
102-303 6.36e-04

Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 41.16  E-value: 6.36e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 102 EIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIgtAMEDAAAGDFTTELDSdtdidaidrIA 181
Cdd:COG4372  89 ELGTAQGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQEL--ARLTKQAQDLQTRLKT---------LA 157
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 182 AAYDRMAADLSVTLDE---LRAFAADVEETSEDVAAEAADIAEMNREVAGDirelADEIADQSEQLHAAVAETNDLSAAI 258
Cdd:COG4372 158 EQRRQLEAQAQSLQASqkqLQASATQLKSQVLDLKLRSAQIEQEAQNLATR----ANAAQARTEELARRAAAAQQTAQAI 233
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*
gi 76802201 259 EEVASTTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAEL 303
Cdd:COG4372 234 QQRDAQISQKAQQIAARAEQIRERERQLQRLETAQARLEQEVAQL 278
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
229-454 8.16e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 41.21  E-value: 8.16e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    229 DIRELADEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVAtqaadaAEVGAEGEQRAEDAIEAIENVGESVAELGSLIE 308
Cdd:TIGR02169  238 QKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELN------KKIKDLGEEEQLRVKEKIGELEAEIASLERSIA 311
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    309 QLEQQMDDVSEttELIDDIAEQTNILALNANIEAARAGGSGGGGAdvgegfavVADEVKSLAEE---TQSAVGEIDGIVE 385
Cdd:TIGR02169  312 EKERELEDAEE--RLAKLEAEIDKLLAEIEELEREIEEERKRRDK--------LTEEYAELKEEledLRAELEEVDKEFA 381
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 76802201    386 TAHADVRDVTAEMEATTEEVDQSVETVTEAGETFQSLTGTVEDIDTAMQDIAKATDEGASGTEEVAATI 454
Cdd:TIGR02169  382 ETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEI 450
COG1511 COG1511
Predicted membrane protein [Function unknown]
76-333 1.01e-03

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 40.57  E-value: 1.01e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201  76 LQRLTDTAAAIEQGELDESVDSRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTA 155
Cdd:COG1511 278 VQDLAAGVPQLNQGISALAAGLSLPDSLGDQFSSLQEALTQIAQGLKQKTSSSLEAAQGSLSSLQSMLALSKSLDLTAEG 357
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 156 MEDAAAGDFTTELDSDTDIDAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREVAGDIRE--- 232
Cdd:COG1511 358 ATVDALGAPDGVQWLDESQKTLATLSELLSTGIDGVSEGLDALEQASAQLAKSLAKLKTAVAQIAASIAQLLPGASEvlk 437
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201 233 -------------LADEIADQSEQLHAAVAETND---------LSAAIEEVASTTDEVAT------QAADAAEVGAEGEQ 284
Cdd:COG1511 438 tlkskgldkllnqLNGALAKGSNALVQGLSDANDsfrsitsaqLKAGLNTLADGSNDLSSlgpglgQLADGSKLLADGLS 517
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|...
gi 76802201 285 RAEDAIEAI-ENVGESVAELGSL---IEQLEQQMDDVSETTELIDDIAEQTNI 333
Cdd:COG1511 518 ELNTGSAQLrDGLGELSDGLTELadsLQDAADQLSLANDSDKQASFIANPVEL 570
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
75-330 2.14e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 39.67  E-value: 2.14e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201     75 ELQRLTDTAAAIEQ--GELDESVDSRRNDEIGSLFSAFDDMRLSLKTALEESEAA-------KQDAQAARQEAEQLNEAL 145
Cdd:TIGR02169  766 RIEELEEDLHKLEEalNDLEARLSHSRIPEIQAELSKLEEEVSRIEARLREIEQKlnrltleKEYLEKEIQELQEQRIDL 845
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    146 LEHADEIGTAMEDaaagdftteldSDTDIDAIDRIAAaydrmaadlsvtldELRAFAADVEETSEDVAAEAADIAEMNRE 225
Cdd:TIGR02169  846 KEQIKSIEKEIEN-----------LNGKKEELEEELE--------------ELEAALRDLESRLGDLKKERDELEAQLRE 900
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    226 VAGDIRELADEI---ADQSEQLHAAVAETNDLSAAIEEVASTTDEVATQAADAAEVGAEgEQRAEDAIEAIENVG----- 297
Cdd:TIGR02169  901 LERKIEELEAQIekkRKRLSELKAKLEALEEELSEIEDPKGEDEEIPEEELSLEDVQAE-LQRVEEEIRALEPVNmlaiq 979
                          250       260       270
                   ....*....|....*....|....*....|....*.
gi 76802201    298 ---ESVAELGSLIEQLEQQMDDVSETTELIDDIAEQ 330
Cdd:TIGR02169  980 eyeEVLKRLDELKEKRAKLEEERKAILERIEEYEKK 1015
AAA_27 pfam13514
AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain ...
107-335 4.71e-03

AAA domain; This domain is found in a number of double-strand DNA break proteins. This domain contains a P-loop motif.


Pssm-ID: 257834 [Multi-domain]  Cd Length: 1112  Bit Score: 38.63  E-value: 4.71e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    107 FSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAAGDFTTELDSDTDIDAIDRIAAAYDR 186
Cdd:pfam13514  676 RASLDERLSQAEHALETAEERHDEAQSALEEWQEQWYDLLLEAGLGGRASPVGALDALELLQNIKEKLQAADDLRQRIAQ 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    187 MAADLSVTLDELRAFA-----ADVEETSEDVAAEAADIAEMNREVAGDIRELADEIADQSEQLHAAVAETNDLSAAIEEV 261
Cdd:pfam13514  756 MERDLARFAEEVEALAkalapEMLATPADELARALKARLKRARDTAAEADRLAEEIEEAEKQVSTAAAALDELEARLTAL 835
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    262 AS----TTDEVATQAADAAEVGAEGEQRAEDAIEAIENVGESVAELGSLIEQLEQQMDDVSETTEL----IDDIAEQTNI 333
Cdd:pfam13514  836 LRaarvTTIEELLAAVERSDTYRELRRRLAALERTLERICGGLSLEALAAEKAALDPAELPARLELlardIEELEEELNE 915

                   ..
gi 76802201    334 LA 335
Cdd:pfam13514  916 LA 917
PTZ00121 PTZ00121
MAEBL; Provisional
75-376 5.97e-03

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 38.58  E-value: 5.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    75 ELQRLTDTAAAIEQGELDESVdsRRNDEIGSLFSAFDDMRLSLKTALEESEAAKQDAQAARQEAEQlneallehADEIGT 154
Cdd:PTZ00121 1228 AVKKAEEAKKDAEEAKKAEEE--RNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKAEEKKK--------ADEAKK 1297
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   155 AMEDAAAGDFTTELDSDTDIDAIDRIAAAYDRMAADLSVTLDELRAfAADVEETSEDVAAEAADIAEMNREVAGDIRELA 234
Cdd:PTZ00121 1298 AEEKKKADEAKKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKK-AAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEA 1376
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201   235 DEIADQSEQLHAAVAETNDLSAAIEEVASTTDEVaTQAADAAEVGAEGEQRAEDAIEAIEnvGESVAELGSLIEQLEQQM 314
Cdd:PTZ00121 1377 KKKADAAKKKAEEKKKADEAKKKAEEDKKKADEL-KKAAAAKKKADEAKKKAEEKKKADE--AKKKAEEAKKADEAKKKA 1453
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 76802201   315 DDVSETTELIDDIAEQTNILALNANIEAARAGGSGGGGADVGEGfavVADEVKSLAEETQSA 376
Cdd:PTZ00121 1454 EEAKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKK---KADEAKKAAEAKKKA 1512
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
72-327 6.48e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233758 [Multi-domain]  Cd Length: 1164  Bit Score: 38.13  E-value: 6.48e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201     72 VTVELQRLTDTAAAIEQ--GELDESVDSRRNDEIGSLFSAFDDM---RLSLKTALEESEAAKQDAQAARQEAEQLNEALL 146
Cdd:TIGR02169  256 LTEEISELEKRLEEIEQllEELNKKIKDLGEEEQLRVKEKIGELeaeIASLERSIAEKERELEDAEERLAKLEAEIDKLL 335
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    147 EHADEIGTAMEDAAAgdftteldsdtdidAIDRIAAAYDRMAADLSVTLDELRAFAADVEETSEDVAAEAADIAEMNREV 226
Cdd:TIGR02169  336 AEIEELEREIEEERK--------------RRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREI 401
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    227 aGDIRELADEIADQSEQLHAAVAE-TNDLSAAIEEVAsttdevatqaadaaevgaEGEQRAEDAIEAIEnvgESVAELGS 305
Cdd:TIGR02169  402 -NELKRELDRLQEELQRLSEELADlNAAIAGIEAKIN------------------ELEEEKEDKALEIK---KQEWKLEQ 459
                          250       260
                   ....*....|....*....|..
gi 76802201    306 LIEQLEQQMDDVSETTELIDDI 327
Cdd:TIGR02169  460 LAADLSKYEQELYDLKEEYDRV 481
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
116-330 7.44e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.11  E-value: 7.44e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    116 SLKTALEESEAAKQDAQAARQEAEQLNEALLEHADEIGTAMEDAAAGDFTTELDSDTDIDAIDRIAAAYDRMAADLSVTL 195
Cdd:TIGR02168  800 ALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALL 879
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 76802201    196 DELRAFAADVEETSEDVAAEAADIAEMNREVaGDIRELADEIADQSEQLHAAVAET-----NDLSAAIEEVASTTDEVAT 270
Cdd:TIGR02168  880 NERASLEEALALLRSELEELSEELRELESKR-SELRRELEELREKLAQLELRLEGLevridNLQERLSEEYSLTLEEAEA 958
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 76802201    271 QAADAAEVGAEGEQRAE--------------DAIEAIENVGESVAELGSLIEQLEQQMDDVSETTELIDDIAEQ 330
Cdd:TIGR02168  959 LENKIEDDEEEARRRLKrlenkikelgpvnlAAIEEYEELKERYDFLTAQKEDLTEAKETLEEAIEEIDREARE 1032
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH