NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7669492|ref|NP_002037|]
View 

glyceraldehyde-3-phosphate dehydrogenase isoform 1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
157-314 4.02e-97

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


:

Pssm-ID: 251539  Cd Length: 158  Bit Score: 287.14  E-value: 4.02e-97
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    157 LAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVP 236
Cdd:pfam02800   1 LAPLAKVLNDNFGIEKGLMTTVHAYTADQKLVDGPHHKDLRRGRAAAPNIIPTSTGAAKAVGLVLPELKGKLTGMAFRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7669492    237 TANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWY 314
Cdd:pfam02800  81 TPNVSVVDLTVELEKPVTVEEVNAALKEAAEGALKGILGYTEEPLVSSDFIGDPHSSIFDAKATIVLNGNFVKVVAWY 158
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
4-152 1.02e-81

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


:

Pssm-ID: 214851  Cd Length: 149  Bit Score: 247.46  E-value: 1.02e-81
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492       4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPDVEVVAINDL-TDPEYLAYLLKYDSVHGRFPGTVEVEGDGLVVNGKAIKVFAERDPA 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASC 152
Cdd:smart00846  80 NLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDAdPTFVYGVNHDEYDGEDHIISNASC 149
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
3-335 0e+00

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]


:

Pssm-ID: 223135 [Multi-domain]  Cd Length: 335  Bit Score: 514.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    3 KVKVGVNGFGRIGRLVTRAAFNSGK-VDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERD 81
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDGdIEVVAINDL-TDPDYLAHLLKYDSVHGRFDGEVEVKDDALVVNGKGIKVLAERD 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASCTTNCLAP 159
Cdd:COG0057  80 PANLPWADLGVDIVVECTGKFTGREKAEKHLkAGGAKKVLISAPGKDDvATVVYGVNHNYYDAGHTIVSNASCTTNCLAP 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  160 LAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSgKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTAN 239
Cdd:COG0057 160 VAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPH-KDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPN 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  240 VSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFG 319
Cdd:COG0057 239 VSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWG 318
                       330
                ....*....|....*.
gi 7669492  320 YSNRVVDLMAHMASKE 335
Cdd:COG0057 319 YSNRVVDLLAMVAKAL 334
 
Name Accession Description Interval E-value
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
157-314 4.02e-97

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 251539  Cd Length: 158  Bit Score: 287.14  E-value: 4.02e-97
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    157 LAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVP 236
Cdd:pfam02800   1 LAPLAKVLNDNFGIEKGLMTTVHAYTADQKLVDGPHHKDLRRGRAAAPNIIPTSTGAAKAVGLVLPELKGKLTGMAFRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7669492    237 TANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWY 314
Cdd:pfam02800  81 TPNVSVVDLTVELEKPVTVEEVNAALKEAAEGALKGILGYTEEPLVSSDFIGDPHSSIFDAKATIVLNGNFVKVVAWY 158
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
4-152 1.02e-81

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 247.46  E-value: 1.02e-81
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492       4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPDVEVVAINDL-TDPEYLAYLLKYDSVHGRFPGTVEVEGDGLVVNGKAIKVFAERDPA 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASC 152
Cdd:smart00846  80 NLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDAdPTFVYGVNHDEYDGEDHIISNASC 149
Gp_dh_N pfam00044
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
4-152 1.66e-81

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 249536  Cd Length: 150  Bit Score: 247.03  E-value: 1.66e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFiDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:pfam00044   1 IKVGINGFGRIGRLVLRAALAQDDLEVVAINDLT-DPETLAYLLKYDSVHGRFDGEVEVDEDGLIVNGKKIKVFAERDPA 79
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7669492     84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSAD--APMFVMGVNHEKYDNSLKIISNASC 152
Cdd:pfam00044  80 ELPWGELGVDIVVESTGVFTTAEKAEAHLKAGAKKVIISAPAKDdaDPTFVYGVNHDDYDPEDDIVSNASC 150
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
3-335 0e+00

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]


Pssm-ID: 223135 [Multi-domain]  Cd Length: 335  Bit Score: 514.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    3 KVKVGVNGFGRIGRLVTRAAFNSGK-VDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERD 81
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDGdIEVVAINDL-TDPDYLAHLLKYDSVHGRFDGEVEVKDDALVVNGKGIKVLAERD 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASCTTNCLAP 159
Cdd:COG0057  80 PANLPWADLGVDIVVECTGKFTGREKAEKHLkAGGAKKVLISAPGKDDvATVVYGVNHNYYDAGHTIVSNASCTTNCLAP 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  160 LAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSgKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTAN 239
Cdd:COG0057 160 VAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPH-KDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPN 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  240 VSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFG 319
Cdd:COG0057 239 VSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWG 318
                       330
                ....*....|....*.
gi 7669492  320 YSNRVVDLMAHMASKE 335
Cdd:COG0057 319 YSNRVVDLLAMVAKAL 334
PLN02272 PLN02272
glyceraldehyde-3-phosphate dehydrogenase
2-332 0e+00

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 177912 [Multi-domain]  Cd Length: 421  Bit Score: 602.62  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGNPITIFQER 80
Cdd:PLN02272  84 GKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNFKGTINVvDDSTLEINGKQIKVTSKR 163
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    81 DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL 160
Cdd:PLN02272 164 DPAEIPWGDFGAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPL 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PLN02272 244 AKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNV 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PLN02272 324 SVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGY 403
                        330
                 ....*....|..
gi 7669492   321 SNRVVDLMAHMA 332
Cdd:PLN02272 404 SNRVLDLIEHMA 415
PTZ00023 PTZ00023
glyceraldehyde-3-phosphate dehydrogenase; Provisional
4-335 0e+00

glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173322 [Multi-domain]  Cd Length: 337  Bit Score: 508.99  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:PTZ00023   3 VKLGINGFGRIGRLVFRAALEREDVEVVAINDPFMTLDYMCYLLKYDSVHGSLPAEVSVTDGFLMIGSKKVHVFFEKDPA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAP-SADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAK 162
Cdd:PTZ00023  83 AIPWGKNGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPpKDDTPIYVMGVNHTQYDKSQRIVSNASCTTNCLAPLAK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   163 VIHDNFGIVEGLMTTVHAITATQKTVDGPS--GKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PTZ00023 163 VVNDKFGIVEGLMTTVHASTANQLTVDGPSkgGKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVPDV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PTZ00023 243 SVVDLTCKLAKPAKYEEIVAAVKKAAEGPLKGILGYTDDEVVSSDFVHDKRSSIFDVKAGIALNDTFVKLVSWYDNEWGY 322
                        330
                 ....*....|....*
gi 7669492   321 SNRVVDLMAHMASKE 335
Cdd:PTZ00023 323 SNRLLDLAHYITQKY 337
Glyceraldehyde-3-phosphate_dehydrogenase TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
5-326 8.92e-171

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675 [Multi-domain]  Cd Length: 326  Bit Score: 481.01  E-value: 8.92e-171
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      5 KVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPIT-IFQERD 81
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPgnDLEVVAINDL-TDLEKLAYLLKYDSVHGRFEGEVTVDEDGLVVNGKEVIsVFSERD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASCTTNCLAPL 160
Cdd:TIGR01534  80 PSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDvKTIVYGVNHDEYDGEERIISNASCTTNCLAPL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKlWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:TIGR01534 160 AKVLDEAFGIVSGLMTTVHAYTNDQNLLDGPHKD-LRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTPNV 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIA--LNDHFVKLISWYDNEF 318
Cdd:TIGR01534 239 SLVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVtgLGDSLVKVYAWYDNEW 318

                  ....*...
gi 7669492    319 GYSNRVVD 326
Cdd:TIGR01534 319 GYSNRLVD 326
gapA PRK15425
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
4-332 1.08e-155

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 185323 [Multi-domain]  Cd Length: 331  Bit Score: 443.02  E-value: 1.08e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDpFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:PRK15425   3 IKVGINGFGRIGRIVFRAAQKRSDIEIVAIND-LLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSAD-APMFVMGVNHEKYDNSlKIISNASCTTNCLAPLAK 162
Cdd:PRK15425  82 NLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDnTPMFVKGANFDKYAGQ-DIVSNASCTTNCLAPLAK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   163 VIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSV 242
Cdd:PRK15425 161 VINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   243 VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSN 322
Cdd:PRK15425 241 VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSN 320
                        330
                 ....*....|
gi 7669492   323 RVVDLMAHMA 332
Cdd:PRK15425 321 KVLDLIAHIS 330
 
Name Accession Description Interval E-value
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
157-314 4.02e-97

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 251539  Cd Length: 158  Bit Score: 287.14  E-value: 4.02e-97
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    157 LAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVP 236
Cdd:pfam02800   1 LAPLAKVLNDNFGIEKGLMTTVHAYTADQKLVDGPHHKDLRRGRAAAPNIIPTSTGAAKAVGLVLPELKGKLTGMAFRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7669492    237 TANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWY 314
Cdd:pfam02800  81 TPNVSVVDLTVELEKPVTVEEVNAALKEAAEGALKGILGYTEEPLVSSDFIGDPHSSIFDAKATIVLNGNFVKVVAWY 158
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
4-152 1.02e-81

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 247.46  E-value: 1.02e-81
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492       4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPDVEVVAINDL-TDPEYLAYLLKYDSVHGRFPGTVEVEGDGLVVNGKAIKVFAERDPA 79
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASC 152
Cdd:smart00846  80 NLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDAdPTFVYGVNHDEYDGEDHIISNASC 149
Gp_dh_N pfam00044
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
4-152 1.66e-81

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 249536  Cd Length: 150  Bit Score: 247.03  E-value: 1.66e-81
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFiDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:pfam00044   1 IKVGINGFGRIGRLVLRAALAQDDLEVVAINDLT-DPETLAYLLKYDSVHGRFDGEVEVDEDGLIVNGKKIKVFAERDPA 79
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7669492     84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSAD--APMFVMGVNHEKYDNSLKIISNASC 152
Cdd:pfam00044  80 ELPWGELGVDIVVESTGVFTTAEKAEAHLKAGAKKVIISAPAKDdaDPTFVYGVNHDDYDPEDDIVSNASC 150
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
3-335 0e+00

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]


Pssm-ID: 223135 [Multi-domain]  Cd Length: 335  Bit Score: 514.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    3 KVKVGVNGFGRIGRLVTRAAFNSGK-VDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERD 81
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDGdIEVVAINDL-TDPDYLAHLLKYDSVHGRFDGEVEVKDDALVVNGKGIKVLAERD 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASCTTNCLAP 159
Cdd:COG0057  80 PANLPWADLGVDIVVECTGKFTGREKAEKHLkAGGAKKVLISAPGKDDvATVVYGVNHNYYDAGHTIVSNASCTTNCLAP 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  160 LAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSgKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTAN 239
Cdd:COG0057 160 VAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPH-KDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPN 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492  240 VSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFG 319
Cdd:COG0057 239 VSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWG 318
                       330
                ....*....|....*.
gi 7669492  320 YSNRVVDLMAHMASKE 335
Cdd:COG0057 319 YSNRVVDLLAMVAKAL 334
PLN02272 PLN02272
glyceraldehyde-3-phosphate dehydrogenase
2-332 0e+00

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 177912 [Multi-domain]  Cd Length: 421  Bit Score: 602.62  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGNPITIFQER 80
Cdd:PLN02272  84 GKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNFKGTINVvDDSTLEINGKQIKVTSKR 163
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    81 DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL 160
Cdd:PLN02272 164 DPAEIPWGDFGAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPL 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PLN02272 244 AKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNV 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PLN02272 324 SVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGY 403
                        330
                 ....*....|..
gi 7669492   321 SNRVVDLMAHMA 332
Cdd:PLN02272 404 SNRVLDLIEHMA 415
PTZ00023 PTZ00023
glyceraldehyde-3-phosphate dehydrogenase; Provisional
4-335 0e+00

glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173322 [Multi-domain]  Cd Length: 337  Bit Score: 508.99  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:PTZ00023   3 VKLGINGFGRIGRLVFRAALEREDVEVVAINDPFMTLDYMCYLLKYDSVHGSLPAEVSVTDGFLMIGSKKVHVFFEKDPA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAP-SADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAK 162
Cdd:PTZ00023  83 AIPWGKNGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPpKDDTPIYVMGVNHTQYDKSQRIVSNASCTTNCLAPLAK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   163 VIHDNFGIVEGLMTTVHAITATQKTVDGPS--GKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PTZ00023 163 VVNDKFGIVEGLMTTVHASTANQLTVDGPSkgGKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVPDV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PTZ00023 243 SVVDLTCKLAKPAKYEEIVAAVKKAAEGPLKGILGYTDDEVVSSDFVHDKRSSIFDVKAGIALNDTFVKLVSWYDNEWGY 322
                        330
                 ....*....|....*
gi 7669492   321 SNRVVDLMAHMASKE 335
Cdd:PTZ00023 323 SNRLLDLAHYITQKY 337
Glyceraldehyde-3-phosphate_dehydrogenase TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
5-326 8.92e-171

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675 [Multi-domain]  Cd Length: 326  Bit Score: 481.01  E-value: 8.92e-171
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      5 KVGVNGFGRIGRLVTRAAFNSG--KVDIVAINDPfIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPIT-IFQERD 81
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPgnDLEVVAINDL-TDLEKLAYLLKYDSVHGRFEGEVTVDEDGLVVNGKEVIsVFSERD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADA-PMFVMGVNHEKYDNSLKIISNASCTTNCLAPL 160
Cdd:TIGR01534  80 PSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDvKTIVYGVNHDEYDGEERIISNASCTTNCLAPL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKlWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:TIGR01534 160 AKVLDEAFGIVSGLMTTVHAYTNDQNLLDGPHKD-LRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTPNV 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIA--LNDHFVKLISWYDNEF 318
Cdd:TIGR01534 239 SLVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVtgLGDSLVKVYAWYDNEW 318

                  ....*...
gi 7669492    319 GYSNRVVD 326
Cdd:TIGR01534 319 GYSNRLVD 326
PLN02358 PLN02358
glyceraldehyde-3-phosphate dehydrogenase
3-332 3.75e-162

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 165999 [Multi-domain]  Cd Length: 338  Bit Score: 459.57  E-value: 3.75e-162
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     3 KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-NPITIFQER 80
Cdd:PLN02358   5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWkHHELKIKDDKTLLFGeKPVTVFGIR 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    81 DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL 160
Cdd:PLN02358  85 NPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PLN02358 165 AKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDV 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PLN02358 245 SVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGY 324
                        330
                 ....*....|..
gi 7669492   321 SNRVVDLMAHMA 332
Cdd:PLN02358 325 SSRVVDLIVHMS 336
gapA PRK15425
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
4-332 1.08e-155

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 185323 [Multi-domain]  Cd Length: 331  Bit Score: 443.02  E-value: 1.08e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDpFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPS 83
Cdd:PRK15425   3 IKVGINGFGRIGRIVFRAAQKRSDIEIVAIND-LLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    84 KIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSAD-APMFVMGVNHEKYDNSlKIISNASCTTNCLAPLAK 162
Cdd:PRK15425  82 NLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDnTPMFVKGANFDKYAGQ-DIVSNASCTTNCLAPLAK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   163 VIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSV 242
Cdd:PRK15425 161 VINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   243 VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSN 322
Cdd:PRK15425 241 VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSN 320
                        330
                 ....*....|
gi 7669492   323 RVVDLMAHMA 332
Cdd:PRK15425 321 KVLDLIAHIS 330
PRK07729 PRK07729
glyceraldehyde-3-phosphate dehydrogenase; Validated
3-334 2.60e-137

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 236079 [Multi-domain]  Cd Length: 343  Bit Score: 396.41  E-value: 2.60e-137
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     3 KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFiDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDP 82
Cdd:PRK07729   2 KTKVAINGFGRIGRMVFRKAIKESAFEIVAINASY-PSETLAHLIKYDTVHGKFDGTVEAFEDHLLVDGKKIRLLNNRDP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    83 SKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPM-FVMGVNHEKYD-NSLKIISNASCTTNCLAPL 160
Cdd:PRK07729  81 KELPWTDLGIDIVIEATGKFNSKEKAILHVEAGAKKVILTAPGKNEDVtIVVGVNEDQLDiEKHTIISNASCTTNCLAPV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   161 AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV 240
Cdd:PRK07729 161 VKVLDEQFGIENGLMTTVHAYTNDQKNIDNPHKDL-RRARACGQSIIPTTTGAAKALAKVLPHLNGKLHGMALRVPTPNV 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   241 SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY 320
Cdd:PRK07729 240 SLVDLVVDVKRDVTVEEINEAFKTAANGALKGILEFSEEPLVSIDFNTNTHSAIIDGLSTMVMGDRKVKVLAWYDNEWGY 319
                        330
                 ....*....|....
gi 7669492   321 SNRVVDLMAHMASK 334
Cdd:PRK07729 320 SCRVVDLVTLVADE 333
PTZ00434 PTZ00434
cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional
1-335 1.02e-130

cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional


Pssm-ID: 185614 [Multi-domain]  Cd Length: 361  Bit Score: 380.56  E-value: 1.02e-130
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     1 MGKVKVGVNGFGRIGRLVTRAAFNSG----KVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGK--------LV 68
Cdd:PTZ00434   1 MAPIKVGINGFGRIGRMVFQAICDQGligtEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKSSpsvktddvLV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    69 INGNPITIFQ-ERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAP-SADAPMFVMGVNHEKYD-NSLK 145
Cdd:PTZ00434  81 VNGHRIKCVKaQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPaSGGAKTIVMGVNQHEYSpTEHH 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   146 IISNASCTTNCLAPLAKVI-HDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPEL 224
Cdd:PTZ00434 161 VVSNASCTTNCLAPIVHVLtKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPST 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   225 NGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALN 304
Cdd:PTZ00434 241 KGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNRSSIYDSKATLQNN 320
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 7669492   305 ----DHFVKLISWYDNEFGYSNRVVDLMAHMASKE 335
Cdd:PTZ00434 321 lpgeRRFFKIVSWYDNEWGYSHRVVDLVRYMAAKD 355
PRK07403 PRK07403
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
4-334 7.09e-115

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 180962 [Multi-domain]  Cd Length: 337  Bit Score: 339.19  E-value: 7.09e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAF--NSGKVDIVAINDPFiDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERD 81
Cdd:PRK07403   2 IRVAINGFGRIGRNFLRCWLgrENSQLELVAINDTS-DPRTNAHLLKYDSMLGKLNADISADENSITVNGKTIKCVSDRN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAP--SADAPMFVMGVNHEKYD-NSLKIISNASCTTNCLA 158
Cdd:PRK07403  81 PLNLPWKEWGIDLIIESTGVFVTKEGASKHIQAGAKKVLITAPgkGEDIGTYVVGVNHHEYDhEDHNIISNASCTTNCLA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   159 PLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTA 238
Cdd:PRK07403 161 PIAKVLHDNFGIIKGTMTTTHSYTGDQRILDASHRDL-RRARAAAVNIVPTSTGAAKAVALVIPELKGKLNGIALRVPTP 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   239 NVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEF 318
Cdd:PRK07403 240 NVSVVDLVVQVEKRTITEQVNEVLKDASEGPLKGILEYSDLPLVSSDYRGTDASSIVDASLTMVMGGDMVKVIAWYDNEW 319
                        330
                 ....*....|....*.
gi 7669492   319 GYSNRVVDLMAHMASK 334
Cdd:PRK07403 320 GYSQRVVDLAELVARK 335
PRK08955 PRK08955
glyceraldehyde-3-phosphate dehydrogenase; Validated
3-328 3.02e-107

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 169599 [Multi-domain]  Cd Length: 334  Bit Score: 319.37  E-value: 3.02e-107
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     3 KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDP 82
Cdd:PRK08955   2 TIKVGINGFGRIGRLALRAAWDWPEVEFVQINDPAGDAATLAHLLEFDSVHGRWHHEVTAEGDAIVINGKRIRTTQNKAI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    83 SKIKWgdAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMF--VMGVNHEKYDNSL-KIISNASCTTNCLAP 159
Cdd:PRK08955  82 ADTDW--SGCDVVIEASGVMKTKALLQAYLDQGVKRVVVTAPVKEEGVLniVMGVNDHLFDPAIhPIVTAASCTTNCLAP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   160 LAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTAN 239
Cdd:PRK08955 160 VVKVIHEKLGIKHGSMTTIHDLTNTQTILDAPHKDL-RRARACGMSLIPTTTGSATAITEIFPELKGKLNGHAVRVPLAN 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   240 VSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFG 319
Cdd:PRK08955 239 ASLTDCVFEVERDTTVEEVNALLKEAAEGELKGILGYEERPLVSIDYKTDPRSSIVDALSTMVVNGTQVKLYAWYDNEWG 318

                 ....*....
gi 7669492   320 YSNRVVDLM 328
Cdd:PRK08955 319 YANRTAELA 327
PLN03096 PLN03096
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
3-334 3.14e-103

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 215572 [Multi-domain]  Cd Length: 395  Bit Score: 311.48  E-value: 3.14e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     3 KVKVGVNGFGRIGRLVTRA--AFNSGKVDIVAINDPFiDLNYMVYMFQYDSTHGKFHGTVKAE-NGKLVINGNPITIFQE 79
Cdd:PLN03096  60 KIKVAINGFGRIGRNFLRCwhGRKDSPLDVVAINDTG-GVKQASHLLKYDSTLGTFDADVKPVgDDAISVDGKVIKVVSD 138
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    80 RDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPS-ADAPMFVMGVNHEKYDNSLKIISNASCTTNCLA 158
Cdd:PLN03096 139 RNPLNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGkGDIPTYVVGVNADDYKHSDPIISNASCTTNCLA 218
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   159 PLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTA 238
Cdd:PLN03096 219 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDL-RRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTP 297
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   239 NVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEF 318
Cdd:PLN03096 298 NVSVVDLVVQVEKKTFAEEVNAAFRDAAEKELKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW 377
                        330
                 ....*....|....*.
gi 7669492   319 GYSNRVVDLMAHMASK 334
Cdd:PLN03096 378 GYSQRVVDLADIVANK 393
PLN02237 PLN02237
glyceraldehyde-3-phosphate dehydrogenase B
3-334 3.27e-103

glyceraldehyde-3-phosphate dehydrogenase B


Pssm-ID: 215131 [Multi-domain]  Cd Length: 442  Bit Score: 312.99  E-value: 3.27e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     3 KVKVGVNGFGRIGRLVTRA--AFNSGKVDIVAINDPFIDLNyMVYMFQYDSTHGKFHGTVK-AENGKLVINGNPITIFQE 79
Cdd:PLN02237  75 KLKVAINGFGRIGRNFLRCwhGRKDSPLDVVVVNDSGGVKN-ASHLLKYDSMLGTFKADVKiVDDETISVDGKPIKVVSN 153
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    80 RDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPS--ADAPMFVMGVNHEKYDNSL-KIISNASCTTNC 156
Cdd:PLN02237 154 RDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAkgADIPTYVVGVNEDDYDHEVaNIVSNASCTTNC 233
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   157 LAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVP 236
Cdd:PLN02237 234 LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDL-RRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVP 312
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   237 TANVSVVDLTCRLEKPA-KYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYD 315
Cdd:PLN02237 313 TPNVSVVDLVVNVEKKGiTAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYD 392
                        330
                 ....*....|....*....
gi 7669492   316 NEFGYSNRVVDLMAHMASK 334
Cdd:PLN02237 393 NEWGYSQRVVDLAHLVAAK 411
D-erythrose-4-phosphate_dehydrogenase_E4PDH. TIGR01532
erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases ...
5-326 3.20e-99

erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases in gamma-proteobacteria which utilize NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose. This enzyme activity appears to have evolved from glyceraldehyde-3-phosphate dehydrogenase, whose substrate differs only in the lack of one carbon relative to E4P. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]


Pssm-ID: 130595 [Multi-domain]  Cd Length: 325  Bit Score: 298.73  E-value: 3.20e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492      5 KVGVNGFGRIGRLVTRAAFNSGK---VDIVAINDpFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERD 81
Cdd:TIGR01532   1 RVAINGFGRIGRNVLRALYESGRraeITVVAINE-LADAAGMAHLLKYDTSHGRFAWEVRQDRDQLFVGDDAIRVLHERS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSA---DAPMfVMGVNHEKYDNSLKIISNASCTTNCLA 158
Cdd:TIGR01532  80 LQSLPWRELGVDLVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGAsdlDATI-VYGVNQDQLRAEHRIVSNASCTTNCIV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    159 PLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTA 238
Cdd:TIGR01532 159 PVIKLLDDAYGIESGTITTIHSAMNDQQVIDAYHPDL-RRTRAASQSIIPVDTKLAAGIERFFPQFNDRFEAIAVRVPTV 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    239 NVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEF 318
Cdd:TIGR01532 238 NVTAIDLSVTVKKPVKANEVNLLLQKAAQGALRGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLVKTLVWCDNEW 317

                  ....*...
gi 7669492    319 GYSNRVVD 326
Cdd:TIGR01532 318 GFANRMLD 325
PRK13535 PRK13535
erythrose 4-phosphate dehydrogenase; Provisional
4-332 2.25e-98

erythrose 4-phosphate dehydrogenase; Provisional


Pssm-ID: 184122 [Multi-domain]  Cd Length: 336  Bit Score: 296.97  E-value: 2.25e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGK---VDIVAINDpFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQER 80
Cdd:PRK13535   2 IRVAINGFGRIGRNVLRALYESGRraeITVVAINE-LADAEGMAHLLKYDTSHGRFAWDVRQERDQLFVGDDAIRLLHER 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    81 DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSA---DAPMfVMGVNHEKYDNSLKIISNASCTTNCL 157
Cdd:PRK13535  81 DIASLPWRELGVDVVLDCTGVYGSREDGEAHIAAGAKKVLFSHPGSndlDATV-VYGVNHDQLRAEHRIVSNASCTTNCI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   158 APLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLwRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPT 237
Cdd:PRK13535 160 IPVIKLLDDAFGIESGTVTTIHSAMNDQQVIDAYHPDL-RRTRAASQSIIPVDTKLAAGITRIFPQFNDRFEAISVRVPT 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   238 ANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNE 317
Cdd:PRK13535 239 INVTAIDLSVTVKKPVKVNEVNQLLQKAAQGAFHGIVDYTELPLVSIDFNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNE 318
                        330
                 ....*....|....*
gi 7669492   318 FGYSNRVVDLMAHMA 332
Cdd:PRK13535 319 WGFANRMLDTTLAMA 333
PRK08289 PRK08289
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
10-332 1.07e-83

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 236219 [Multi-domain]  Cd Length: 477  Bit Score: 263.32  E-value: 1.07e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    10 GFGRIGRLVTRAAFN-SGKVD------IVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA--ENGKLVINGNPITIFQER 80
Cdd:PRK08289 134 GFGRIGRLLARLLIEkTGGGNglrlraIVVRKGSEGDLEKRASLLRRDSVHGPFNGTITVdeENNAIIANGNYIQVIYAN 213
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    81 DPSKI---KWG--DAgaeYVVESTGVFTTMEKAGAHLQG-GAKRVIISAPS-ADAPMFVMGVNHEKYDNSLKIISNASCT 153
Cdd:PRK08289 214 SPEEVdytAYGinNA---LVVDNTGKWRDEEGLSQHLKSkGVAKVLLTAPGkGDIKNIVHGVNHSDITDEDKIVSAASCT 290
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   154 TNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGpSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAF 233
Cdd:PRK08289 291 TNAITPVLKAVNDKYGIVNGHVETVHSYTNDQNLIDN-YHKGDRRGRSAPLNMVITETGAAKAVAKALPELAGKLTGNAI 369
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   234 RVPTANVSVVDLTCRLEKPAKYDDIKKVVKQAS-EGPLKGILGYTE-HQVVSSDFNSDTHSSTFDAGAGIALNDHFVkLI 311
Cdd:PRK08289 370 RVPTPNVSMAILNLNLEKETSREELNEYLRQMSlHSPLQNQIDYTDsTEVVSSDFVGSRHAGVVDSQATIVNGNRAV-LY 448
                        330       340
                 ....*....|....*....|.
gi 7669492   312 SWYDNEFGYSNRVVDLMAHMA 332
Cdd:PRK08289 449 VWYDNEFGYSCQVVRVMEQMA 469
PTZ00353 PTZ00353
glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional
4-331 2.97e-57

glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173546 [Multi-domain]  Cd Length: 342  Bit Score: 190.86  E-value: 2.97e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492     4 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGT-VKAENGKLVINGNP-ITIFQERD 81
Cdd:PTZ00353   3 ITVGINGFGPVGKAVLFASLTDPLVTVVAVNDASVSIAYIAYVLEQESPLSAPDGAsIRVVGEQIVLNGTQkIRVSAKHD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    82 PSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLA 161
Cdd:PTZ00353  83 LVEIAWRDYGVQYVVECTGLYSTRSRCWGHVTGGAKGVFVAGQSADAPTVMAGSNDERLSASLPVCCAGAPIAVALAPVI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   162 KVIHDNFGIVEGLMTTVHAITAtQKTVDGPS--GKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTAN 239
Cdd:PTZ00353 163 RALHEVYGVEECSYTAIHGMQP-QEPIAARSknSQDWRQTRVAIDAIAPYRDNGAETVCKLLPHLVGRISGSAFQVPVKK 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   240 VSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDThSSTFDAGAGIALNDHFV-KLISWYDNEF 318
Cdd:PTZ00353 242 GCAIDMLVRTKQPVSKEVVDSALAEAASDRLNGVLCISKRDMISVDCIPNG-KLCYDATSSSSSREGEVhKMVLWFDVEC 320
                        330
                 ....*....|...
gi 7669492   319 GYSNRVVDLMAHM 331
Cdd:PTZ00353 321 YYAARLLSLVKQL 333
Asd COG0136
Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]
90-222 1.25e-04

Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]


Pssm-ID: 223214 [Multi-domain]  Cd Length: 334  Bit Score: 41.83  E-value: 1.25e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492   90 AGAEYVVEstgVFTTMEKAGAhlqggakrVIISAPSA-----DAPMFVMGVNHE---KYDNSLKIISNASCTTNCLAPLA 161
Cdd:COG0136  74 AGGSVSKE---VEPKAAEAGC--------VVIDNSSAfrmdpDVPLVVPEVNPEhliDYQKRGFIIANPNCSTIQLVLAL 142
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7669492  162 KVIHDNFGIVEGLMTTVHAIT-ATQKTVDgpsgKLWrDGRGALQNIIPASTGAAKAVGKVIP 222
Cdd:COG0136 143 KPLHDAFGIKRVVVSTYQAVSgAGAEGGV----ELA-GQTDALLNGIPILPIGYPLAFNVIP 199
Aspartate-semialdehyde_dehydrogenase TIGR01296
aspartate-semialdehyde dehydrogenase (peptidoglycan organisms); Two closely related families ...
127-182 1.12e-03

aspartate-semialdehyde dehydrogenase (peptidoglycan organisms); Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. This model represents a branch more closely related to the USG-1 protein than to the other aspartate-semialdehyde dehydrogenases represented in model TIGR00978. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273543 [Multi-domain]  Cd Length: 338  Bit Score: 39.02  E-value: 1.12e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 7669492    127 DAPMFVMGVNHE--KYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAIT 182
Cdd:TIGR01296 100 DVPLVVPEVNFEdlKEFNPKGIIANPNCSTIQMVVVLKPLHDEAKIKRVVVSTYQAVS 157
Aspartate-semialdehyde_dehydrogenase TIGR00978
aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms); Two closely related ...
145-282 4.37e-03

aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms); Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. Separate models are built for the two types in order to exclude the USG-1 protein, found in several species, which is specifically related to the Bacillus subtilis type of aspartate-semialdehyde dehydrogenase. Members of this type are found primarily in organisms that lack peptidoglycan. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 273376 [Multi-domain]  Cd Length: 341  Bit Score: 37.04  E-value: 4.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    145 KIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATqktvdGPSGKlwrDGRGALQNIIPASTGAAKAVGKVIPEL 224
Cdd:TIGR00978 139 FIVTNPNCTTAGLTLALKPLIDAFGIKKVHVTTMQAVSGA-----GYPGV---PSMDILDNIIPHIGGEEEKIERETRKI 210
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669492    225 NGKLTG------------MAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVV 282
Cdd:TIGR00978 211 LGKLENgkiepapfsvsaTTTRVPVLDGHTESVHVEFDKKFDIEEIREALKSFRGLPQKLGLPSAPEKPI 280
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH