NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7669481|ref|NP_004043|]
View 

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BNIP3 pfam06553
BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa ...
1-192 2.63e-77

BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerization, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterized by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation.


:

Pssm-ID: 253797  Cd Length: 197  Bit Score: 232.48  E-value: 2.63e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481      1 MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASV-----SIYNGDMEKILLDAQHESGRS-SSKSSHCDSPPRSQTPQ 74
Cdd:pfam06553   1 MSAQQAPPSSEDGLNGSWVELEMSGNNASSSSPGRLehvpsSSSNGDMEKLLLEAQRESSRSsSRTSSRCDSPPRSPTPP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481     75 DTNRASETDTHSIGEKNS-SQSEEDDIERRKEVesilkKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKK 153
Cdd:pfam06553  81 QESPQTELDVEMDSLRDVyIQSEEEAGEKLKEV-----KNTDWIWDWSSRPENIPPKEFKFVHPKRSVSLSIRKTRVMKK 155
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 7669481    154 GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTS 192
Cdd:pfam06553 156 GGLFSAEFLKVFLPTLLLSHLLGLGLGIYIGKRLTTLTR 194
 
Name Accession Description Interval E-value
BNIP3 pfam06553
BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa ...
1-192 2.63e-77

BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerization, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterized by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation.


Pssm-ID: 253797  Cd Length: 197  Bit Score: 232.48  E-value: 2.63e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481      1 MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASV-----SIYNGDMEKILLDAQHESGRS-SSKSSHCDSPPRSQTPQ 74
Cdd:pfam06553   1 MSAQQAPPSSEDGLNGSWVELEMSGNNASSSSPGRLehvpsSSSNGDMEKLLLEAQRESSRSsSRTSSRCDSPPRSPTPP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481     75 DTNRASETDTHSIGEKNS-SQSEEDDIERRKEVesilkKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKK 153
Cdd:pfam06553  81 QESPQTELDVEMDSLRDVyIQSEEEAGEKLKEV-----KNTDWIWDWSSRPENIPPKEFKFVHPKRSVSLSIRKTRVMKK 155
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 7669481    154 GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTS 192
Cdd:pfam06553 156 GGLFSAEFLKVFLPTLLLSHLLGLGLGIYIGKRLTTLTR 194
 
Name Accession Description Interval E-value
BNIP3 pfam06553
BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa ...
1-192 2.63e-77

BNIP3; This family consists of several mammalian specific BCL2/adenovirus E1B 19-kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerization, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterized by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation.


Pssm-ID: 253797  Cd Length: 197  Bit Score: 232.48  E-value: 2.63e-77
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481      1 MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASV-----SIYNGDMEKILLDAQHESGRS-SSKSSHCDSPPRSQTPQ 74
Cdd:pfam06553   1 MSAQQAPPSSEDGLNGSWVELEMSGNNASSSSPGRLehvpsSSSNGDMEKLLLEAQRESSRSsSRTSSRCDSPPRSPTPP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7669481     75 DTNRASETDTHSIGEKNS-SQSEEDDIERRKEVesilkKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKK 153
Cdd:pfam06553  81 QESPQTELDVEMDSLRDVyIQSEEEAGEKLKEV-----KNTDWIWDWSSRPENIPPKEFKFVHPKRSVSLSIRKTRVMKK 155
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 7669481    154 GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTS 192
Cdd:pfam06553 156 GGLFSAEFLKVFLPTLLLSHLLGLGLGIYIGKRLTTLTR 194
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH