NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|75909587|ref|YP_323883|]
View 

hypothetical protein Ava_3381 [Anabaena variabilis ATCC 29413]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
25-548 0e+00

Predicted unusual protein kinase [General function prediction only]


:

Pssm-ID: 223733  Cd Length: 517  Bit Score: 573.87  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  25 KAYRWNRENYSSKRRFVDIWSFVLTLMFKLWRYNKSWSYPGGVTEAKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTR 104
Cdd:COG0661   3 TLYAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTR 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 105 ADIFPGEYVEELAKLQDKVPAFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLK 184
Cdd:COG0661  83 PDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIR 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 185 KLFEIDLRILKGIARYFQSHPKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRV 264
Cdd:COG0661 163 ERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 265 LTLEYLPGIKISQYEAIEAAGLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREG 344
Cdd:COG0661 243 LTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRY 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 345 LMQTLFGIAQKDGDRVVQSLIDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTF 424
Cdd:COG0661 323 LAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVL 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 425 VMRAFSTLEGVGKGLDPEFNFMEVAQPYAMQLMTDMNGSdsnSFLNELSRQAVQVSTTAFGLPRRLEDTLEKLERgdmRL 504
Cdd:COG0661 403 LQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSP---KLLRELKDEAVAVLNALPLLPRLLRDLLDNDRE---EL 476
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....
gi 75909587 505 RVRSIESERLLRRQGNIQIGIGYALIIsgfTLSATILLVNHYVW 548
Cdd:COG0661 477 SLRSSEELALLLLKAVARLSIGSILLV---VLAVTVLLIAILLL 517
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
45-462 3.53e-126

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


:

Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 380.49  E-value: 3.53e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587    45 SFVLTLMFKLWRYNKSWSYpggvteaKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTRADIFPGEYVEELAKLQDKVP 124
Cdd:TIGR01982  22 SPIGPLSLRLLRRLLLPFS-------NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVP 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   125 AFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLKKLFEIDLRILKGIARYFQSH 204
Cdd:TIGR01982  95 PFDFKVARKVIEAALGGPLEELFAEFEEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERL 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   205 PKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRVLTLEYLPGIKISQYEAIEAA 284
Cdd:TIGR01982 175 SPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEA 254
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   285 GLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREGLMQTLFGIAQKDGDRVVQSL 364
Cdd:TIGR01982 255 GLDRKALAENLARSFLNQVLRDGFFHADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVH 334
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   365 IDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTFVMRAFSTLEGVGKGLDPEFN 444
Cdd:TIGR01982 335 FDAGYVPSDTDMAEFEQAIRAIGEPIFGQPLKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLN 414
                         410
                  ....*....|....*...
gi 75909587   445 FMEVAQPYAMQLMTDMNG 462
Cdd:TIGR01982 415 MWKVAEPFVKRWIRKRLG 432
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
25-548 0e+00

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733  Cd Length: 517  Bit Score: 573.87  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  25 KAYRWNRENYSSKRRFVDIWSFVLTLMFKLWRYNKSWSYPGGVTEAKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTR 104
Cdd:COG0661   3 TLYAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTR 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 105 ADIFPGEYVEELAKLQDKVPAFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLK 184
Cdd:COG0661  83 PDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIR 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 185 KLFEIDLRILKGIARYFQSHPKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRV 264
Cdd:COG0661 163 ERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 265 LTLEYLPGIKISQYEAIEAAGLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREG 344
Cdd:COG0661 243 LTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRY 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 345 LMQTLFGIAQKDGDRVVQSLIDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTF 424
Cdd:COG0661 323 LAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVL 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 425 VMRAFSTLEGVGKGLDPEFNFMEVAQPYAMQLMTDMNGSdsnSFLNELSRQAVQVSTTAFGLPRRLEDTLEKLERgdmRL 504
Cdd:COG0661 403 LQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSP---KLLRELKDEAVAVLNALPLLPRLLRDLLDNDRE---EL 476
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....
gi 75909587 505 RVRSIESERLLRRQGNIQIGIGYALIIsgfTLSATILLVNHYVW 548
Cdd:COG0661 477 SLRSSEELALLLLKAVARLSIGSILLV---VLAVTVLLIAILLL 517
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
74-548 9.18e-90

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 289.11  E-value: 9.18e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   74 ARRKAQ--AVWIRNTLLDLGPTFIKVGQLFSTRADIFPGEYVEELAKLQDKVPAFGYEQVEKIVEQELGKKIPELFHSFE 151
Cdd:PRK04750  44 NRHKDKprGERLRLALEELGPIFVKFGQMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFD 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  152 PIPLAAASLGQVHKAVLHS-GESVVVKVQRPGLKKLFEIDLRILKGIARYFQSHpkWGRGRDW--MGIYEECCRILWEEI 228
Cdd:PRK04750 124 IKPLASASIAQVHFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERL--LPDGRRLkpREVVAEFEKTLHDEL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  229 DYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRVLTLEYLPGIKISQYEAIEAAGLDRKVLARQGAQAYLLQLLNNGF 308
Cdd:PRK04750 202 DLMREAANASQLRRNFEDSDMLYVPEVYWDYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGF 281
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  309 FHADPHPGNIAVSADGAL----IFYDFGMMGQIKSNIREGLMQTLFGIAQKDGDRVVQSLIDLGAIAP---VDDMGPVRR 381
Cdd:PRK04750 282 FHADMHPGNIFVSYDPPEnpryIALDFGIVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGWVPPdtrVEELEFAIR 361
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  382 SVqymLDNFMDKPfenqsvaaisddLYEIAYNQpfrfpatftFVMRAFST---------------------LEGVGKGLD 440
Cdd:PRK04750 362 AV---CEPIFDKP------------LAEISFGH---------VLLRLFNTarrfnveiqpqlvllqktllnVEGLGRQLD 417
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  441 PEFNFMEVAQPYAMQLMTDMNGSDsnSFLNELSRQAVQVSTTAFGLPRRLEDTLE--KLERGDMRLRVRSIESERLLRRQ 518
Cdd:PRK04750 418 PQLDLWKTAKPFLERWMKEQVGPR--ALVRALKEEAPFWAEKLPELPRLVHDSLRqgKLLQHSVDLLAEQLRTNRLRQGQ 495
                        490       500       510
                 ....*....|....*....|....*....|
gi 75909587  519 GNIQIGIGYALIISGftlsaTILLVNHYVW 548
Cdd:PRK04750 496 SRYLLGVGATLLLAG-----TLLLLSRPEL 520
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
137-256 5.22e-51

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 172.39  E-value: 5.22e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   137 QELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLKKLFEIDLRILKGIARYFQSHPKWGrgrDWMGI 216
Cdd:pfam03109   1 EELGAPVEEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKFFPGF---DLDWL 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 75909587   217 YEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVY 256
Cdd:pfam03109  78 VDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
APH_ChoK_like cd05120
Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK ...
230-332 6.52e-06

Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.


Pssm-ID: 240159  Cd Length: 155  Bit Score: 45.09  E-value: 6.52e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 230 YLNEGRNADTFRRNFRGYEWVK-----VPKVYWRYAS-PRVLTL-EYLPGIKISQYEaieaaGLDRKVLARQGAQ--AYL 300
Cdd:cd05120  28 INPSREKGADREREVAILQLLArkglpVPKVLASGESdGWSYLLmEWIEGETLDEVS-----EEEKEDIAEQLAEllAKL 102
                        90       100       110
                ....*....|....*....|....*....|..
gi 75909587 301 LQLLNNGFFHADPHPGNIAVSADGALIFYDFG 332
Cdd:cd05120 103 HQLPLLVLCHGDLHPGNILVDDGKILGIIDWE 134
arch_bud32 TIGR03724
Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated ...
250-333 1.41e-03

Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine [Unknown function, General].


Pssm-ID: 234331  Cd Length: 199  Bit Score: 38.74  E-value: 1.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   250 VKVPKVYWRYASPRVLTLEYLPGIKISqyEAIEAAGLDrkVLARQGAQAYLLQllNNGFFHADPHPGNIAVSADGaLIFY 329
Cdd:TIGR03724  59 VNTPVVYDVDPDNKTIVMEYIEGKPLK--DVIEEGNDE--LLREIGRLVGKLH--KAGIVHGDLTTSNIIVRDDK-LYLI 131

                  ....
gi 75909587   330 DFGM 333
Cdd:TIGR03724 132 DFGL 135
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
45-462 3.53e-126

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 380.49  E-value: 3.53e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587    45 SFVLTLMFKLWRYNKSWSYpggvteaKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTRADIFPGEYVEELAKLQDKVP 124
Cdd:TIGR01982  22 SPIGPLSLRLLRRLLLPFS-------NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVP 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   125 AFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLKKLFEIDLRILKGIARYFQSH 204
Cdd:TIGR01982  95 PFDFKVARKVIEAALGGPLEELFAEFEEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERL 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   205 PKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRVLTLEYLPGIKISQYEAIEAA 284
Cdd:TIGR01982 175 SPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEA 254
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   285 GLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREGLMQTLFGIAQKDGDRVVQSL 364
Cdd:TIGR01982 255 GLDRKALAENLARSFLNQVLRDGFFHADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVH 334
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   365 IDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTFVMRAFSTLEGVGKGLDPEFN 444
Cdd:TIGR01982 335 FDAGYVPSDTDMAEFEQAIRAIGEPIFGQPLKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLN 414
                         410
                  ....*....|....*...
gi 75909587   445 FMEVAQPYAMQLMTDMNG 462
Cdd:TIGR01982 415 MWKVAEPFVKRWIRKRLG 432
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
25-548 0e+00

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733  Cd Length: 517  Bit Score: 573.87  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  25 KAYRWNRENYSSKRRFVDIWSFVLTLMFKLWRYNKSWSYPGGVTEAKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTR 104
Cdd:COG0661   3 TLYAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTR 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 105 ADIFPGEYVEELAKLQDKVPAFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLK 184
Cdd:COG0661  83 PDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIR 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 185 KLFEIDLRILKGIARYFQSHPKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRV 264
Cdd:COG0661 163 ERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRV 242
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 265 LTLEYLPGIKISQYEAIEAAGLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREG 344
Cdd:COG0661 243 LTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRY 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 345 LMQTLFGIAQKDGDRVVQSLIDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTF 424
Cdd:COG0661 323 LAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVL 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 425 VMRAFSTLEGVGKGLDPEFNFMEVAQPYAMQLMTDMNGSdsnSFLNELSRQAVQVSTTAFGLPRRLEDTLEKLERgdmRL 504
Cdd:COG0661 403 LQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWLKKQLSP---KLLRELKDEAVAVLNALPLLPRLLRDLLDNDRE---EL 476
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....
gi 75909587 505 RVRSIESERLLRRQGNIQIGIGYALIIsgfTLSATILLVNHYVW 548
Cdd:COG0661 477 SLRSSEELALLLLKAVARLSIGSILLV---VLAVTVLLIAILLL 517
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
74-548 9.18e-90

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 289.11  E-value: 9.18e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   74 ARRKAQ--AVWIRNTLLDLGPTFIKVGQLFSTRADIFPGEYVEELAKLQDKVPAFGYEQVEKIVEQELGKKIPELFHSFE 151
Cdd:PRK04750  44 NRHKDKprGERLRLALEELGPIFVKFGQMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFD 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  152 PIPLAAASLGQVHKAVLHS-GESVVVKVQRPGLKKLFEIDLRILKGIARYFQSHpkWGRGRDW--MGIYEECCRILWEEI 228
Cdd:PRK04750 124 IKPLASASIAQVHFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWVERL--LPDGRRLkpREVVAEFEKTLHDEL 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  229 DYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRVLTLEYLPGIKISQYEAIEAAGLDRKVLARQGAQAYLLQLLNNGF 308
Cdd:PRK04750 202 DLMREAANASQLRRNFEDSDMLYVPEVYWDYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGF 281
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  309 FHADPHPGNIAVSADGAL----IFYDFGMMGQIKSNIREGLMQTLFGIAQKDGDRVVQSLIDLGAIAP---VDDMGPVRR 381
Cdd:PRK04750 282 FHADMHPGNIFVSYDPPEnpryIALDFGIVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGWVPPdtrVEELEFAIR 361
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  382 SVqymLDNFMDKPfenqsvaaisddLYEIAYNQpfrfpatftFVMRAFST---------------------LEGVGKGLD 440
Cdd:PRK04750 362 AV---CEPIFDKP------------LAEISFGH---------VLLRLFNTarrfnveiqpqlvllqktllnVEGLGRQLD 417
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  441 PEFNFMEVAQPYAMQLMTDMNGSDsnSFLNELSRQAVQVSTTAFGLPRRLEDTLE--KLERGDMRLRVRSIESERLLRRQ 518
Cdd:PRK04750 418 PQLDLWKTAKPFLERWMKEQVGPR--ALVRALKEEAPFWAEKLPELPRLVHDSLRqgKLLQHSVDLLAEQLRTNRLRQGQ 495
                        490       500       510
                 ....*....|....*....|....*....|
gi 75909587  519 GNIQIGIGYALIISGftlsaTILLVNHYVW 548
Cdd:PRK04750 496 SRYLLGVGATLLLAG-----TLLLLSRPEL 520
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
137-256 5.22e-51

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 172.39  E-value: 5.22e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   137 QELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLKKLFEIDLRILKGIARYFQSHPKWGrgrDWMGI 216
Cdd:pfam03109   1 EELGAPVEEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKFFPGF---DLDWL 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 75909587   217 YEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVY 256
Cdd:pfam03109  78 VDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
APH_ChoK_like cd05120
Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK ...
230-332 6.52e-06

Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.


Pssm-ID: 240159  Cd Length: 155  Bit Score: 45.09  E-value: 6.52e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 230 YLNEGRNADTFRRNFRGYEWVK-----VPKVYWRYAS-PRVLTL-EYLPGIKISQYEaieaaGLDRKVLARQGAQ--AYL 300
Cdd:cd05120  28 INPSREKGADREREVAILQLLArkglpVPKVLASGESdGWSYLLmEWIEGETLDEVS-----EEEKEDIAEQLAEllAKL 102
                        90       100       110
                ....*....|....*....|....*....|..
gi 75909587 301 LQLLNNGFFHADPHPGNIAVSADGALIFYDFG 332
Cdd:cd05120 103 HQLPLLVLCHGDLHPGNILVDDGKILGIIDWE 134
COG3642 COG3642
Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
226-333 8.17e-04

Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]


Pssm-ID: 226168  Cd Length: 204  Bit Score: 39.57  E-value: 8.17e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 226 EEIDY-LNEGRNADTFRRNFRGYEW-VKVPKVYWRYASPRVLTLEYLPGIKISQYeaIEAAGLDrkVLARQGAQAYLLQl 303
Cdd:COG3642  35 PELDEkLRRERTRREARILAKAREAgVPVPIVYDVDPDNGLIVMEYIEGELLKDA--LEEARPD--LLREVGRLVGKLH- 109
                        90       100       110
                ....*....|....*....|....*....|
gi 75909587 304 lNNGFFHADPHPGNIAVSADGaLIFYDFGM 333
Cdd:COG3642 110 -KAGIVHGDLTTSNIILSGGR-IYFIDFGL 137
arch_bud32 TIGR03724
Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated ...
250-333 1.41e-03

Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine [Unknown function, General].


Pssm-ID: 234331  Cd Length: 199  Bit Score: 38.74  E-value: 1.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   250 VKVPKVYWRYASPRVLTLEYLPGIKISqyEAIEAAGLDrkVLARQGAQAYLLQllNNGFFHADPHPGNIAVSADGaLIFY 329
Cdd:TIGR03724  59 VNTPVVYDVDPDNKTIVMEYIEGKPLK--DVIEEGNDE--LLREIGRLVGKLH--KAGIVHGDLTTSNIIVRDDK-LYLI 131

                  ....
gi 75909587   330 DFGM 333
Cdd:TIGR03724 132 DFGL 135
PRK14879 PRK14879
serine/threonine protein kinase; Provisional
250-332 1.68e-03

serine/threonine protein kinase; Provisional


Pssm-ID: 237847  Cd Length: 211  Bit Score: 38.73  E-value: 1.68e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587  250 VKVPKVYWRYASPRVLTLEYLPGIKISqyEAIEAAGLDRKVLARQ-GAQAYLLQllNNGFFHADPHPGNIAVSaDGALIF 328
Cdd:PRK14879  61 VNVPAVYFVDPENFIIVMEYIEGEPLK--DLINSNGMEELELSREiGRLVGKLH--SAGIIHGDLTTSNMILS-GGKIYL 135

                 ....
gi 75909587  329 YDFG 332
Cdd:PRK14879 136 IDFG 139
STKc_CCRK cd07832
Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase; Serine/Threonine ...
264-333 2.25e-03

Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase; Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of heart failure.


Pssm-ID: 173736 [Multi-domain]  Cd Length: 286  Bit Score: 38.81  E-value: 2.25e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 75909587 264 VLTLEYLPGikiSQYEAIEAAgldRKVLARQGAQAYLLQLLN-------NGFFHADPHPGNIAVSADGALIFYDFGM 333
Cdd:cd07832  75 VLVMEYMPS---DLSEVLRDE---ERPLPEAQVKSYMRMLLKgvaymhaNGIMHRDLKPANLLISADGVLKIADFGL 145
STKc_MEKK1_plant cd06632
Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1; Serine ...
218-340 4.01e-03

Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1; Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidopsis thaliana MEKK1 activates MPK4, a MAPK that regulates systemic acquired resistance. MEKK1 also participates in the regulation of temperature-sensitive and tissue-specific cell death.


Pssm-ID: 132963 [Multi-domain]  Cd Length: 258  Bit Score: 37.79  E-value: 4.01e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587 218 EECCRILWEEIDYLNEGRNADTFRrnFRGYEwvkvpkvywRYASPRVLTLEYLPGIKISqyeaieaagldrKVLARQGA- 296
Cdd:cd06632  43 QEAVKQLEQEIALLSKLQHPNIVQ--YLGTE---------REEDNLYIFLELVPGGSLA------------KLLKKYGSf 99
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 75909587 297 -----QAYLLQLL-------NNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSN 340
Cdd:cd06632 100 pepviRLYTRQILlgleylhDRNTVHRDIKGANILVDTNGVVKLADFGMAKQVVEF 155
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
45-462 3.53e-126

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 380.49  E-value: 3.53e-126
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587    45 SFVLTLMFKLWRYNKSWSYpggvteaKQAARRKAQAVWIRNTLLDLGPTFIKVGQLFSTRADIFPGEYVEELAKLQDKVP 124
Cdd:TIGR01982  22 SPIGPLSLRLLRRLLLPFS-------NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVP 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   125 AFGYEQVEKIVEQELGKKIPELFHSFEPIPLAAASLGQVHKAVLHSGESVVVKVQRPGLKKLFEIDLRILKGIARYFQSH 204
Cdd:TIGR01982  95 PFDFKVARKVIEAALGGPLEELFAEFEEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERL 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   205 PKWGRGRDWMGIYEECCRILWEEIDYLNEGRNADTFRRNFRGYEWVKVPKVYWRYASPRVLTLEYLPGIKISQYEAIEAA 284
Cdd:TIGR01982 175 SPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEA 254
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   285 GLDRKVLARQGAQAYLLQLLNNGFFHADPHPGNIAVSADGALIFYDFGMMGQIKSNIREGLMQTLFGIAQKDGDRVVQSL 364
Cdd:TIGR01982 255 GLDRKALAENLARSFLNQVLRDGFFHADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVH 334
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75909587   365 IDLGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTFVMRAFSTLEGVGKGLDPEFN 444
Cdd:TIGR01982 335 FDAGYVPSDTDMAEFEQAIRAIGEPIFGQPLKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLN 414
                         410
                  ....*....|....*...
gi 75909587   445 FMEVAQPYAMQLMTDMNG 462
Cdd:TIGR01982 415 MWKVAEPFVKRWIRKRLG 432
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH