NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|73964853|ref|XP_850487|]
View 

PREDICTED: regulatory-associated protein of mTOR isoformX2 [Canis lupus familiaris]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 1.98e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


:

Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.45  E-value: 1.98e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  602 EKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLV 671
Cdd:cd00020   52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 2.15e-97

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


:

Pssm-ID: 258678  Cd Length: 154  Bit Score: 308.81  E-value: 2.15e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 73964853    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.62e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 98.95  E-value: 2.62e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1027 SVVKFHPFTPCVAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIMSVSVNGDVRFFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1262 HPQANLIACGSMNqftaiysgngeliNHIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
HEAT_EZ pfam13513
HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats ...
571-626 8.52e-03

HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). These EZ repeats are found in subunits of cyanobacterial phycocyanin lyase and other proteins and probably carry out a scaffolding role.


:

Pssm-ID: 257833  Cd Length: 55  Bit Score: 35.89  E-value: 8.52e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 73964853    571 PLLRQWVAICLGRIWQNFDSARwCGVRDSAHEKLCSLLSDPIPEVRCAAVFALGTF 626
Cdd:pfam13513    1 WEVREAAALALGALAGVGPELL-RPAVPELLPALLPLLKDDDDEVREAAAWALGRI 55
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 2.71e-21

FOG: WD40 repeat [General function prediction only]


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 97.47  E-value: 2.71e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1019 LNRNPGVPSVVKFHPFTPCVAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKayLQKHPEGHIMSVSV--NGDVRFFDPRMPESVNVLQIVK 1254
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSS--LSFSPDGSLLVSGGsdDGTIRLWDLRTGKPLKTLEGHS 371
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1255 GLTALDIHPQANLIACGSMNQFTAIYSGNGELINHikyydgFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  372 NVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLR------NLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 4.56e-06

HEAT repeats; This family includes multiple HEAT repeats.


:

Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 46.18  E-value: 4.56e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLCSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 73964853    646 mMLAQLINDGSPVVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 1.98e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.45  E-value: 1.98e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  602 EKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLV 671
Cdd:cd00020   52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 2.15e-97

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 308.81  E-value: 2.15e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 73964853    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.62e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 98.95  E-value: 2.62e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1027 SVVKFHPFTPCVAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIMSVSVNGDVRFFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1262 HPQANLIACGSMNqftaiysgngeliNHIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
HEAT pfam02985
HEAT repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see ...
604-627 8.05e-03

HEAT repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514).


Pssm-ID: 251659  Cd Length: 31  Bit Score: 35.95  E-value: 8.05e-03
                           10        20
                   ....*....|....*....|....
gi 73964853    604 LCSLLSDPIPEVRCAAVFALGTFV 627
Cdd:pfam02985    5 LLELLNDPSPEVREAAAEALGALA 28
HEAT_EZ pfam13513
HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats ...
571-626 8.52e-03

HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). These EZ repeats are found in subunits of cyanobacterial phycocyanin lyase and other proteins and probably carry out a scaffolding role.


Pssm-ID: 257833  Cd Length: 55  Bit Score: 35.89  E-value: 8.52e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 73964853    571 PLLRQWVAICLGRIWQNFDSARwCGVRDSAHEKLCSLLSDPIPEVRCAAVFALGTF 626
Cdd:pfam13513    1 WEVREAAALALGALAGVGPELL-RPAVPELLPALLPLLKDDDDEVREAAAWALGRI 55
WD40 pfam00400
WD domain, G-beta repeat;
1302-1329 9.54e-03

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 35.80  E-value: 9.54e-03
                           10        20
                   ....*....|....*....|....*...
gi 73964853   1302 GAISCLAFHPHWPHLAVGSNDYYISVYS 1329
Cdd:pfam00400   12 GPVTSVAFSPDGNLLASGSDDGTVRVWD 39
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 2.71e-21

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 97.47  E-value: 2.71e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1019 LNRNPGVPSVVKFHPFTPCVAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKayLQKHPEGHIMSVSV--NGDVRFFDPRMPESVNVLQIVK 1254
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSS--LSFSPDGSLLVSGGsdDGTIRLWDLRTGKPLKTLEGHS 371
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1255 GLTALDIHPQANLIACGSMNQFTAIYSGNGELINHikyydgFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  372 NVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLR------NLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 4.56e-06

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 46.18  E-value: 4.56e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLCSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 73964853    646 mMLAQLINDGSPVVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking and secretion]
472-696 1.64e-05

Vesicle coat complex, various subunits [Intracellular trafficking and secretion]


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 47.80  E-value: 1.64e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096   56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  543 vnsyntgQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLcsLLSDPIPEVRCAAVFA 622
Cdd:COG5096  120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLVVQYESN---FCT-VALQFMEEEKNYPLPS 696
Cdd:COG5096  190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPDSaedFEErLSPPLQHNNAEVLLIA 265
 
Name Accession Description Interval E-value
ARM cd00020
Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated ...
602-671 1.98e-03

Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.


Pssm-ID: 237987 [Multi-domain]  Cd Length: 120  Bit Score: 38.45  E-value: 1.98e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  602 EKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDhsTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLV 671
Cdd:cd00020   52 PALVQLLKSEDEEVVKAALWALRNLAAGPEDNKL--IVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119
Raptor_N pfam14538
Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor ...
54-207 2.15e-97

Raptor N-terminal CASPase like domain; This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.


Pssm-ID: 258678  Cd Length: 154  Bit Score: 308.81  E-value: 2.15e-97
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853     54 RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKL 133
Cdd:pfam14538    1 RMKTVSVALVLCLNIGVDPPDVRKTNPCARLECWIDPSVLPPSKALETIGKALQSQYERWQPKARYKQSVDPTVEDVKRL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 73964853    134 CTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK 207
Cdd:pfam14538   81 CQSLRRNAKDERVLFHYNGHGVPRPTENGEIWVFNKNYTQYIPLSIYELQSWLGSPSIYIFDCSNAGSLLNAFK 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1027-1322 2.62e-22

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 98.95  E-value: 2.62e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1027 SVVKFHPFTPCVAVADKDSICF-WDWEKGEKLDYF--HNGNPRYTRVTAmeylngqDCSLLLTATDDGAIRVWknfaDLE 1103
Cdd:cd00200   13 TCVAFSPDGKLLATGSGDGTIKvWDLETGELLRTLkgHTGPVRDVAASA-------DGTYLASGSSDKTIRLW----DLE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1104 KNpEMVTAWQGLSDMLpttrgagMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIpTGADSCVTSLSCDSHRSLIVA 1183
Cdd:cd00200   82 TG-ECVRTLTGHTSYV-------SSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTL-RGHTDWVNSVAFSPDGTFVAS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1184 GLGDGSIRVYDrrMALSECrVMTYREHTAWVVKayLQKHPEG-HIMSVSVNGDVRFFDPRMPESVNVLQI-VKGLTALDI 1261
Cdd:cd00200  153 SSQDGTIKLWD--LRTGKC-VATLTGHTGEVNS--VAFSPDGeKLLSSSSDGTIKLWDLSTGKCLGTLRGhENGVNSVAF 227
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1262 HPQANLIACGSMNqftaiysgngeliNHIKYYDGFMGQRV-------GAISCLAFHPHWPHLAVGSND 1322
Cdd:cd00200  228 SPDGYLLASGSED-------------GTIRVWDLRTGECVqtlsghtNSVTSLAWSPDGKRLASGSAD 282
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1123-1330 2.52e-16

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 80.07  E-value: 2.52e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1123 RGAGMVVDWEQETGLLMSSGDVRIVRIWDTDReMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRmalSEC 1202
Cdd:cd00200    9 TGGVTCVAFSPDGKLLATGSGDGTIKVWDLET-GELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLE---TGE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1203 RVMTYREHTAWVvkAYLQKHPEGHIMSVS-VNGDVRFFDPRMPESVNVLQ-IVKGLTALDIHPQANLIACGSMNQFTAIY 1280
Cdd:cd00200   85 CVRTLTGHTSYV--SSVAFSPDGRILSSSsRDKTIKVWDVETGKCLTTLRgHTDWVNSVAFSPDGTFVASSSQDGTIKLW 162
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 73964853 1281 SGNGELINHIkyydgFMGqRVGAISCLAFHPHWPHLAVGSNDYYISVYSV 1330
Cdd:cd00200  163 DLRTGKCVAT-----LTG-HTGEVNSVAFSPDGEKLLSSSSDGTIKLWDL 206
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
1029-1240 3.64e-14

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 73.52  E-value: 3.64e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1029 VKFHPFTPCVAVADKDSICF-WDWEKGEKLDYF--HNGNprytrVTAMEYLngQDCSLLLTATDDGAIRVWknfaDLEKN 1105
Cdd:cd00200   57 VAASADGTYLASGSSDKTIRlWDLETGECVRTLtgHTSY-----VSSVAFS--PDGRILSSSSRDKTIKVW----DVETG 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1106 pEMVTAWQGLSDmlpttrgAGMVVDWEQETGLLMSSGDVRIVRIWDT--------------------------------- 1152
Cdd:cd00200  126 -KCLTTLRGHTD-------WVNSVAFSPDGTFVASSSQDGTIKLWDLrtgkcvatltghtgevnsvafspdgekllssss 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1153 DREMKVQDIPTGADSC--------VTSLSCDSHRSLIVAGLGDGSIRVYDRRMAlsECrVMTYREHTAWVVKAYLqkHPE 1224
Cdd:cd00200  198 DGTIKLWDLSTGKCLGtlrghengVNSVAFSPDGYLLASGSEDGTIRVWDLRTG--EC-VQTLSGHTNSVTSLAW--SPD 272
                        250
                 ....*....|....*..
gi 73964853 1225 GH-IMSVSVNGDVRFFD 1240
Cdd:cd00200  273 GKrLASGSADGTIRIWD 289
HEAT pfam02985
HEAT repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see ...
604-627 8.05e-03

HEAT repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514).


Pssm-ID: 251659  Cd Length: 31  Bit Score: 35.95  E-value: 8.05e-03
                           10        20
                   ....*....|....*....|....
gi 73964853    604 LCSLLSDPIPEVRCAAVFALGTFV 627
Cdd:pfam02985    5 LLELLNDPSPEVREAAAEALGALA 28
HEAT_EZ pfam13513
HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats ...
571-626 8.52e-03

HEAT-like repeat; The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). These EZ repeats are found in subunits of cyanobacterial phycocyanin lyase and other proteins and probably carry out a scaffolding role.


Pssm-ID: 257833  Cd Length: 55  Bit Score: 35.89  E-value: 8.52e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 73964853    571 PLLRQWVAICLGRIWQNFDSARwCGVRDSAHEKLCSLLSDPIPEVRCAAVFALGTF 626
Cdd:pfam13513    1 WEVREAAALALGALAGVGPELL-RPAVPELLPALLPLLKDDDDEVREAAAWALGRI 55
WD40 pfam00400
WD domain, G-beta repeat;
1302-1329 9.54e-03

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 35.80  E-value: 9.54e-03
                           10        20
                   ....*....|....*....|....*...
gi 73964853   1302 GAISCLAFHPHWPHLAVGSNDYYISVYS 1329
Cdd:pfam00400   12 GPVTSVAFSPDGNLLASGSDDGTVRVWD 39
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1019-1332 2.71e-21

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 97.47  E-value: 2.71e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1019 LNRNPGVPSVVKFHPFTPCVAVA--DKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNgqdcSLLLTATDDGAIRVW 1096
Cdd:COG2319  151 LEGHSESVTSLAFSPDGKLLASGssLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGG----LLIASGSSDGTIRLW 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1097 knfaDLEKNPEMVTAWQGLSDMLpttrgagmVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDS 1176
Cdd:COG2319  227 ----DLSTGKLLRSTLSGHSDSV--------VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSP 294
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1177 HRSLIVAGLGDGSIRVYDRRMaLSECRVMTYREHTAWVVKayLQKHPEGHIMSVSV--NGDVRFFDPRMPESVNVLQIVK 1254
Cdd:COG2319  295 DGKLLASGSSDGTVRLWDLET-GKLLSSLTLKGHEGPVSS--LSFSPDGSLLVSGGsdDGTIRLWDLRTGKPLKTLEGHS 371
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853 1255 GLTALDIHPQANLIACGSMNQFTAIYSGNGELINHikyydgFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEK 1332
Cdd:COG2319  372 NVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLR------NLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKT 443
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1082-1333 1.35e-15

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 79.75  E-value: 1.35e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1082 SLLLTATDDGAIRVWknfaDLEKNPEMVTAWQGLSDmLPTTRGAGMVVDweQETGLLMSSGDVRIVRIWDTDREMKVQDI 1161
Cdd:COG2319   78 ELLLSGSSDGTIKLW----DLDNGEKLIKSLEGLHD-SSVSKLALSSPD--GNSILLASSSLDGTVKLWDLSTPGKLIRT 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1162 PTGADSCVTSLS-CDSHRSLIVAGLGDGSIRVYDRRmalSECRVMTYREHTAWVVKayLQKHPEG--HIMSVSVNGDVRF 1238
Cdd:COG2319  151 LEGHSESVTSLAfSPDGKLLASGSSLDGTIKLWDLR---TGKPLSTLAGHTDPVSS--LAFSPDGglLIASGSSDGTIRL 225
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1239 FDPRMPESV-NVLQIVKGLTALDIHPQANLIACGSMNQFTAIYSgNGELINHIKYYDGfmgqRVGAISCLAFHPHWPHLA 1317
Cdd:COG2319  226 WDLSTGKLLrSTLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWD-LRSSSSLLRTLSG----HSSSVLSVAFSPDGKLLA 300
                        250
                 ....*....|....*.
gi 73964853 1318 VGSNDYYISVYSVEKR 1333
Cdd:COG2319  301 SGSSDGTVRLWDLETG 316
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
566-668 4.56e-06

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 46.18  E-value: 4.56e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853    566 LNDPHPLLRQWVAICLGRIWQnfdsarwcgvrDSAHEKLCSLLSDPIPEVRCAAVFALGtfvgnsaeRTDHSTTIDHnva 645
Cdd:pfam13646    9 LSDPDPEVRAAAARALGELGD-----------PEALPALLELLKDPDPEVRRAAAEALG--------KLGDPEALPA--- 66
                           90       100
                   ....*....|....*....|...
gi 73964853    646 mMLAQLINDGSPVVRKELVVALS 668
Cdd:pfam13646   67 -LLELLQDDEDAVVRAAAASALA 88
COG5096 COG5096
Vesicle coat complex, various subunits [Intracellular trafficking and secretion]
472-696 1.64e-05

Vesicle coat complex, various subunits [Intracellular trafficking and secretion]


Pssm-ID: 227427 [Multi-domain]  Cd Length: 757  Bit Score: 47.80  E-value: 1.64e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  472 IFPYVLKLLQSSARELRPLLVFIW---AK------ILAVDSscqadLVKDNGHKyflsvlaDPYMpaehRTMTAFILAVI 542
Cdd:COG5096   56 LFPDVIKNVATRDVELKRLLYLYLeryAKlkpelaLLAVNT-----IQKDLQDP-------NEEI----RGFALRTLSLL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853  543 vnsyntgQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQnFDSARWCGVRDSAHEKLcsLLSDPIPEVRCAAVFA 622
Cdd:COG5096  120 -------RVKELLGNIIDPIKKLLTDPHAYVRKTAALAVAKLYR-LDKDLYHELGLIDILKE--LVADSDPIVIANALAS 189
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853  623 LGTFVGNSAErtDHSTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLVVQYESN---FCT-VALQFMEEEKNYPLPS 696
Cdd:COG5096  190 LAEIDPELAH--GYSLEVILRIPQLDLLSLSVSTEWLLLIILEVLTERVPTTPDSaedFEErLSPPLQHNNAEVLLIA 265
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
1163-1332 2.04e-05

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 47.39  E-value: 2.04e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1163 TGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMalSECRVMTYREHTAWVVKAYLQKHPEGHIM---SVSVNGDVRFF 1239
Cdd:COG2319   62 RGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDN--GEKLIKSLEGLHDSSVSKLALSSPDGNSIllaSSSLDGTVKLW 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73964853 1240 DPRMP-ESVNVLQIVKG-LTALDIHPQANLIACGSMNQFTaIYSGNGELINHIKYYDGfmgqRVGAISCLAFHPHWPHLA 1317
Cdd:COG2319  140 DLSTPgKLIRTLEGHSEsVTSLAFSPDGKLLASGSSLDGT-IKLWDLRTGKPLSTLAG----HTDPVSSLAFSPDGGLLI 214
                        170
                 ....*....|....*.
gi 73964853 1318 VG-SNDYYISVYSVEK 1332
Cdd:COG2319  215 ASgSSDGTIRLWDLST 230
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
559-624 3.30e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 40.40  E-value: 3.30e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 73964853    559 IAICLEQLNDPHPLLRQWVAICLGRIwqnfdsarwcGvRDSAHEKLCSLL-SDPIPEVRCAAVFALG 624
Cdd:pfam13646   33 LPALLELLKDPDPEVRRAAAEALGKL----------G-DPEALPALLELLqDDEDAVVRAAAASALA 88
HEAT_2 pfam13646
HEAT repeats; This family includes multiple HEAT repeats.
607-670 3.91e-04

HEAT repeats; This family includes multiple HEAT repeats.


Pssm-ID: 257956 [Multi-domain]  Cd Length: 88  Bit Score: 40.40  E-value: 3.91e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 73964853    607 LLSDPIPEVRCAAVFALGTFVGNSAERTdhsttidhnvammLAQLINDGSPVVRKELVVALSHL 670
Cdd:pfam13646    8 LLSDPDPEVRAAAARALGELGDPEALPA-------------LLELLKDPDPEVRRAAAEALGKL 58
COG1413 COG1413
FOG: HEAT repeat [Energy production and conversion]
557-624 1.58e-03

FOG: HEAT repeat [Energy production and conversion]


Pssm-ID: 224331 [Multi-domain]  Cd Length: 335  Bit Score: 41.06  E-value: 1.58e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 73964853  557 NLIAICLEQLNDPHPLLRQWVAICLGRIwqnFDSARWcgvrdsAHEKLCSLLSDPIPEVRCAAVFALG 624
Cdd:COG1413  180 EAIPLLIELLEDEDADVRRAAASALGQL---GSENVE------AADLLVKALSDESLEVRKAALLALG 238
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH