NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6981062|ref|NP_037280.1|]
View 

5-hydroxytryptamine receptor 5A

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
63-338 1.52e-59

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 194.44  E-value: 1.52e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062     63 ATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRrWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWS 142
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGD-WPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    143 ITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSE-ECQ-----VSREPSYTVFSTVGAFYLPLCVV 216
Cdd:pfam00001  80 IVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVtTCLidfpeESTLRSYTLLSTLLGFVLPLLVI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    217 LFVYWKIYKAAKfrmgsrktnsvspipeavevkdasqhpqmvftvRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVL 296
Cdd:pfam00001 160 LVCYTLILRTLR---------------------------------KRARSGASQARAKRSSSKERKAAKMLLVVVVVFVL 206
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 6981062    297 CWFPFFVTELISPLC---SWDIPALWKSIFLWLGYSNSFFNPLIY 338
Cdd:pfam00001 207 CWLPYHIVLLLDSLCplsIIRLLPTALLITLWLAYVNSCLNPIIY 251
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
63-338 1.52e-59

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 194.44  E-value: 1.52e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062     63 ATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRrWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWS 142
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGD-WPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    143 ITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSE-ECQ-----VSREPSYTVFSTVGAFYLPLCVV 216
Cdd:pfam00001  80 IVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVtTCLidfpeESTLRSYTLLSTLLGFVLPLLVI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    217 LFVYWKIYKAAKfrmgsrktnsvspipeavevkdasqhpqmvftvRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVL 296
Cdd:pfam00001 160 LVCYTLILRTLR---------------------------------KRARSGASQARAKRSSSKERKAAKMLLVVVVVFVL 206
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 6981062    297 CWFPFFVTELISPLC---SWDIPALWKSIFLWLGYSNSFFNPLIY 338
Cdd:pfam00001 207 CWLPYHIVLLLDSLCplsIIRLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
58-350 8.53e-05

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 42.46  E-value: 8.53e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    58 NLLVLaTILRVRTFHRVPHNLVASMAISDvLVAVLVMPLSLVHELSgRRWQLGRRLCQLWIACDVLCCTASIWNVTAIAL 137
Cdd:PHA03087  58 NIIVI-YVLTKTKIKTPMDIYLLNLAVSD-LLFVMTLPFQIYYYIL-FQWSFGEFACKIVSGLYYIGFYNSMNFITVMSV 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062   138 DRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSEECQVSREPSY------TVFSTVGAFYL 211
Cdd:PHA03087 135 DRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNKTMnwklfiNFEINIIGMLI 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062   212 PLCVVLFVYWKIYKAAKfrmGSRKTNsvspipeavevkdasqhpqmvftvrhatvtfqtegdtwreqKEQRAALMVGILI 291
Cdd:PHA03087 215 PLTILLYCYSKILITLK---GINKSK-----------------------------------------KNKKAIKLVLIIV 250
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 6981062   292 GVFVLCWFPFFVTELISPLCSWDIPALWKSIFLW---------LGYSNSFFNPLIYTAFNRSYSSAFK 350
Cdd:PHA03087 251 ILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKYIqyalhvteiISLSHCCINPLIYAFVSEFFNKHKK 318
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
63-338 1.52e-59

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 194.44  E-value: 1.52e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062     63 ATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRrWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWS 142
Cdd:pfam00001   1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGD-WPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    143 ITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSE-ECQ-----VSREPSYTVFSTVGAFYLPLCVV 216
Cdd:pfam00001  80 IVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVEEGNVtTCLidfpeESTLRSYTLLSTLLGFVLPLLVI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    217 LFVYWKIYKAAKfrmgsrktnsvspipeavevkdasqhpqmvftvRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVL 296
Cdd:pfam00001 160 LVCYTLILRTLR---------------------------------KRARSGASQARAKRSSSKERKAAKMLLVVVVVFVL 206
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 6981062    297 CWFPFFVTELISPLC---SWDIPALWKSIFLWLGYSNSFFNPLIY 338
Cdd:pfam00001 207 CWLPYHIVLLLDSLCplsIIRLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
58-350 8.53e-05

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 42.46  E-value: 8.53e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062    58 NLLVLaTILRVRTFHRVPHNLVASMAISDvLVAVLVMPLSLVHELSgRRWQLGRRLCQLWIACDVLCCTASIWNVTAIAL 137
Cdd:PHA03087  58 NIIVI-YVLTKTKIKTPMDIYLLNLAVSD-LLFVMTLPFQIYYYIL-FQWSFGEFACKIVSGLYYIGFYNSMNFITVMSV 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062   138 DRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFGWGETYSELSEECQVSREPSY------TVFSTVGAFYL 211
Cdd:PHA03087 135 DRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNKTMnwklfiNFEINIIGMLI 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6981062   212 PLCVVLFVYWKIYKAAKfrmGSRKTNsvspipeavevkdasqhpqmvftvrhatvtfqtegdtwreqKEQRAALMVGILI 291
Cdd:PHA03087 215 PLTILLYCYSKILITLK---GINKSK-----------------------------------------KNKKAIKLVLIIV 250
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 6981062   292 GVFVLCWFPFFVTELISPLCSWDIPALWKSIFLW---------LGYSNSFFNPLIYTAFNRSYSSAFK 350
Cdd:PHA03087 251 ILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKYIqyalhvteiISLSHCCINPLIYAFVSEFFNKHKK 318
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH