NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|66880553|ref|NP_000126|]
View 

Fanconi anemia group A protein isoform a [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Fanconi_A_N pfam15865
Fanconi anaemia group A protein N terminus;
172-522 0e+00

Fanconi anaemia group A protein N terminus;


:

Pssm-ID: 292490  Cd Length: 335  Bit Score: 547.68  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    172 KIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQmfvlrgfqkns 251
Cdd:pfam15865    1 KVQNSLLLEVLWQLQELNILTASEYIESHEDSEAVQQWLFRFLCLLCEQIEASCQSTEVERALLSDFVR----------- 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    252 dlrRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFgVFSGHTLGSVISTDPLKRFFSHTLTQILTHS 331
Cdd:pfam15865   70 ---RAAEDEKMSQILTAVLQDMLSNLLDALAANPQIESLNYVAVRCWF-VFSGHTLCSSLPDDALKRFFNHHLTQLLTLH 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    332 PVLKASDAVQMQREWSFARTHPLLTSLYRRLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWV 411
Cdd:pfam15865  146 PVLKVSDAIQMQSEWSFERTDELLTTLYRRLFVKLSPEELLGALQEVLETHEVNWKHVLSLVSTLAVCLPEAQQLIKDWL 225
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    412 ARLMAQAFESCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRgYHGCSKKALVFLFTFLSELVPFESPRYLQV 491
Cdd:pfam15865  226 KRLLLRAFESGDLESMVTAFLTARQAALEGPAVFPSYADWFKQSFGEMS-YHSLSKKALVFLLKFLSDLVPFEAPQYLKV 304
                          330       340       350
                   ....*....|....*....|....*....|.
gi 66880553    492 HILHPPLVPGKYRSLLTDYISLAKTRLADLK 522
Cdd:pfam15865  305 HILIPPSVPGKYRSLLQDYKTLARTRLADLK 335
Fanconi_A pfam03511
Fanconi anaemia group A protein;
1266-1312 4.99e-19

Fanconi anaemia group A protein;


:

Pssm-ID: 281506  Cd Length: 63  Bit Score: 83.94  E-value: 4.99e-19
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 66880553   1266 MGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESD 1312
Cdd:pfam03511   13 MGLLSSHLTPKEAVDSLKALEVCAEILGCLEKRKVSWLVLFQLTETD 59
 
Name Accession Description Interval E-value
Fanconi_A_N pfam15865
Fanconi anaemia group A protein N terminus;
172-522 0e+00

Fanconi anaemia group A protein N terminus;


Pssm-ID: 292490  Cd Length: 335  Bit Score: 547.68  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    172 KIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQmfvlrgfqkns 251
Cdd:pfam15865    1 KVQNSLLLEVLWQLQELNILTASEYIESHEDSEAVQQWLFRFLCLLCEQIEASCQSTEVERALLSDFVR----------- 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    252 dlrRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFgVFSGHTLGSVISTDPLKRFFSHTLTQILTHS 331
Cdd:pfam15865   70 ---RAAEDEKMSQILTAVLQDMLSNLLDALAANPQIESLNYVAVRCWF-VFSGHTLCSSLPDDALKRFFNHHLTQLLTLH 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    332 PVLKASDAVQMQREWSFARTHPLLTSLYRRLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWV 411
Cdd:pfam15865  146 PVLKVSDAIQMQSEWSFERTDELLTTLYRRLFVKLSPEELLGALQEVLETHEVNWKHVLSLVSTLAVCLPEAQQLIKDWL 225
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    412 ARLMAQAFESCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRgYHGCSKKALVFLFTFLSELVPFESPRYLQV 491
Cdd:pfam15865  226 KRLLLRAFESGDLESMVTAFLTARQAALEGPAVFPSYADWFKQSFGEMS-YHSLSKKALVFLLKFLSDLVPFEAPQYLKV 304
                          330       340       350
                   ....*....|....*....|....*....|.
gi 66880553    492 HILHPPLVPGKYRSLLTDYISLAKTRLADLK 522
Cdd:pfam15865  305 HILIPPSVPGKYRSLLQDYKTLARTRLADLK 335
Fanconi_A pfam03511
Fanconi anaemia group A protein;
1266-1312 4.99e-19

Fanconi anaemia group A protein;


Pssm-ID: 281506  Cd Length: 63  Bit Score: 83.94  E-value: 4.99e-19
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 66880553   1266 MGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESD 1312
Cdd:pfam03511   13 MGLLSSHLTPKEAVDSLKALEVCAEILGCLEKRKVSWLVLFQLTETD 59
 
Name Accession Description Interval E-value
Fanconi_A_N pfam15865
Fanconi anaemia group A protein N terminus;
172-522 0e+00

Fanconi anaemia group A protein N terminus;


Pssm-ID: 292490  Cd Length: 335  Bit Score: 547.68  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    172 KIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQmfvlrgfqkns 251
Cdd:pfam15865    1 KVQNSLLLEVLWQLQELNILTASEYIESHEDSEAVQQWLFRFLCLLCEQIEASCQSTEVERALLSDFVR----------- 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    252 dlrRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFgVFSGHTLGSVISTDPLKRFFSHTLTQILTHS 331
Cdd:pfam15865   70 ---RAAEDEKMSQILTAVLQDMLSNLLDALAANPQIESLNYVAVRCWF-VFSGHTLCSSLPDDALKRFFNHHLTQLLTLH 145
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    332 PVLKASDAVQMQREWSFARTHPLLTSLYRRLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWV 411
Cdd:pfam15865  146 PVLKVSDAIQMQSEWSFERTDELLTTLYRRLFVKLSPEELLGALQEVLETHEVNWKHVLSLVSTLAVCLPEAQQLIKDWL 225
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66880553    412 ARLMAQAFESCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRgYHGCSKKALVFLFTFLSELVPFESPRYLQV 491
Cdd:pfam15865  226 KRLLLRAFESGDLESMVTAFLTARQAALEGPAVFPSYADWFKQSFGEMS-YHSLSKKALVFLLKFLSDLVPFEAPQYLKV 304
                          330       340       350
                   ....*....|....*....|....*....|.
gi 66880553    492 HILHPPLVPGKYRSLLTDYISLAKTRLADLK 522
Cdd:pfam15865  305 HILIPPSVPGKYRSLLQDYKTLARTRLADLK 335
Fanconi_A pfam03511
Fanconi anaemia group A protein;
1266-1312 4.99e-19

Fanconi anaemia group A protein;


Pssm-ID: 281506  Cd Length: 63  Bit Score: 83.94  E-value: 4.99e-19
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 66880553   1266 MGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESD 1312
Cdd:pfam03511   13 MGLLSSHLTPKEAVDSLKALEVCAEILGCLEKRKVSWLVLFQLTETD 59
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH